SitesBLAST
Comparing Ac3H11_1083 FitnessBrowser__acidovorax_3H11:Ac3H11_1083 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
28% identity, 90% coverage: 11:409/443 of query aligns to 15:421/425 of O59010
- S65 (≠ V55) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ T269) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ TSS 269:271) binding
- M311 (≠ L304) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ F307) binding
- V355 (= V348) binding
- D394 (≠ G382) binding
- M395 (≠ I383) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R385) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N389) binding
- D405 (≠ N393) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
27% identity, 89% coverage: 11:404/443 of query aligns to 6:407/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
27% identity, 90% coverage: 11:407/443 of query aligns to 15:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L36), F46 (≠ L36), P75 (≠ D65), L91 (≠ V82), F95 (≠ I86), L130 (= L126), I133 (≠ F134), I159 (= I160), Y167 (vs. gap), K196 (= K189), G200 (≠ L193), I207 (≠ L200), F210 (≠ L203), L250 (≠ I243), I262 (≠ L255), M269 (≠ L262), T334 (= T327), V335 (≠ M328), G336 (≠ T329), T340 (= T333), L343 (≠ A336), M399 (≠ L387)
- binding aspartic acid: S277 (= S270), S278 (= S271), T314 (≠ F307), G354 (= G347), A358 (≠ S351), G359 (≠ A352), D394 (≠ G382), R397 (= R385), T398 (≠ A386)
- binding sodium ion: Y89 (≠ F80), T92 (≠ V83), S93 (≠ T84), G306 (= G299), T308 (≠ S301), N310 (= N303), N310 (= N303), M311 (≠ L304), D312 (= D305), S349 (= S342), I350 (≠ K343), T352 (≠ A345), N401 (= N389), V402 (≠ L390), D405 (≠ N393)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
28% identity, 89% coverage: 11:405/443 of query aligns to 7:409/409 of 6bavA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
27% identity, 89% coverage: 11:404/443 of query aligns to 12:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G59), V83 (≠ L77), I157 (≠ V161), Y164 (vs. gap), K193 (= K189), T305 (≠ S301), I306 (≠ F302), I347 (≠ K343)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ V12), M199 (≠ I195), S275 (= S271), T311 (≠ F307), G356 (≠ A352), L384 (= L375), D391 (≠ G382), R394 (= R385)
Sites not aligning to the query:
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
27% identity, 89% coverage: 11:404/443 of query aligns to 7:408/408 of 6bauA
- binding cysteine: S270 (= S271), M303 (≠ L304), T306 (≠ F307), A345 (≠ H346), G346 (= G347), V347 (= V348), G351 (≠ A352), D386 (≠ G382), C389 (≠ R385), T390 (≠ A386), N393 (= N389)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
28% identity, 86% coverage: 33:411/443 of query aligns to 39:421/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
28% identity, 86% coverage: 33:411/443 of query aligns to 38:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ K189), G195 (≠ L193), R282 (vs. gap)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ T269), S272 (= S270), S273 (= S271), M307 (≠ L304), T310 (≠ F307), G353 (= G350), A354 (≠ S351), R394 (= R385), T395 (≠ A386)
Sites not aligning to the query:
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
28% identity, 86% coverage: 33:411/443 of query aligns to 41:423/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
28% identity, 86% coverage: 33:411/443 of query aligns to 41:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ T269), S275 (= S270), S276 (= S271), T313 (≠ F307), G353 (= G347), V354 (= V348), A357 (≠ S351), G358 (≠ A352), D394 (≠ G382), R397 (= R385), T398 (≠ A386)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K189), G198 (≠ L193), Y202 (≠ L197)
- binding sodium ion: Y87 (≠ F80), T90 (≠ V83), S91 (≠ T84), S276 (= S271), G305 (= G299), A306 (≠ Y300), T307 (≠ S301), N309 (= N303), N309 (= N303), M310 (≠ L304), D311 (= D305), S348 (= S342), I349 (≠ K343), G350 (= G344), T351 (≠ A345), N401 (= N389), V402 (≠ L390), D405 (≠ N393)
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
27% identity, 86% coverage: 33:411/443 of query aligns to 34:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ T269), S265 (= S271), M299 (≠ L304), T302 (≠ F307), T340 (≠ A345), G342 (= G347), V343 (= V348), G347 (≠ A352), D383 (≠ G382), R386 (= R385), T387 (≠ A386), N390 (= N389)
- binding decyl-beta-d-maltopyranoside: V212 (≠ L218), A216 (≠ G222)
Sites not aligning to the query:
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
27% identity, 89% coverage: 11:404/443 of query aligns to 7:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
29% identity, 85% coverage: 19:395/443 of query aligns to 33:393/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V69), G89 (= G70), G92 (= G73), A95 (≠ S76), V96 (≠ L77), Y99 (≠ F80), M163 (≠ I160), F167 (≠ C164), F293 (≠ L294), V297 (≠ T298)
- binding aspartic acid: S268 (= S270), S269 (= S271), T306 (≠ F307), G346 (= G347), I347 (≠ V348), A350 (≠ S351), G351 (≠ A352), D380 (≠ G382), R383 (= R385), T384 (≠ A386)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
28% identity, 85% coverage: 19:395/443 of query aligns to 25:379/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I60), S80 (≠ V69), G81 (= G70), G84 (= G73), Y91 (≠ F80), M156 (≠ I160), F160 (≠ C164), F286 (≠ L294), V290 (≠ T298)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (= I51), I148 (≠ V152), S262 (= S271), S263 (≠ D272), A292 (≠ Y300), T293 (≠ S301), M296 (≠ L304), T299 (≠ F307), G329 (= G344), A336 (≠ S351), G337 (≠ A352), D366 (≠ G382), R369 (= R385), N373 (= N389)
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
26% identity, 90% coverage: 37:435/443 of query aligns to 79:518/532 of O35874
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7nsgA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with hip-b
26% identity, 74% coverage: 70:397/443 of query aligns to 79:413/430 of 7nsgA
- binding (+)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: S287 (= S271), D398 (≠ G382), R401 (= R385), T402 (≠ A386), N405 (= N389)
- binding (-)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: P366 (= P349), D398 (≠ G382), R401 (= R385), T402 (≠ A386)
- binding cholesterol hemisuccinate: I258 (= I243)
Sites not aligning to the query:
6s3qA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with tfb-tboa
26% identity, 74% coverage: 70:397/443 of query aligns to 79:413/430 of 6s3qA
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: S286 (= S270), S287 (= S271), T324 (≠ F307), A358 (≠ T341), G361 (= G344), V365 (= V348), A368 (≠ S351), T372 (≠ V355), D398 (≠ G382), R401 (= R385), T402 (≠ A386), N405 (= N389)
- binding cholesterol hemisuccinate: K80 (≠ R71), R84 (≠ K75)
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
27% identity, 83% coverage: 27:393/443 of query aligns to 37:403/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S270), S281 (= S271), T318 (≠ F307), G363 (≠ A352), M367 (≠ L356), V385 (≠ L375), D388 (= D378), R395 (= R385), T396 (≠ A386)
- binding dodecyl beta-D-glucopyranoside: W389 (= W379)
- binding cholesterol hemisuccinate: R80 (= R71), R84 (≠ K75), I95 (= I86), I252 (≠ V239)
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
26% identity, 83% coverage: 27:393/443 of query aligns to 36:404/425 of 7xr4A
6x2zA Heaat3-ofs-asp (see paper)
27% identity, 74% coverage: 70:397/443 of query aligns to 73:403/419 of 6x2zA
- binding aspartic acid: S275 (≠ T269), S277 (= S271), T314 (≠ F307), G354 (= G347), V355 (= V348), D388 (≠ G382), R391 (= R385), T392 (≠ A386)
- binding sodium ion: Y83 (≠ F80), T86 (≠ V83), T87 (= T84), G306 (= G299), A307 (≠ Y300), T308 (≠ S301), I309 (≠ F302), N310 (= N303), N310 (= N303), M311 (≠ L304), M311 (≠ L304), D312 (= D305), S349 (= S342), I350 (≠ K343), G351 (= G344), A352 (= A345), N395 (= N389), D399 (≠ N393)
Query Sequence
>Ac3H11_1083 FitnessBrowser__acidovorax_3H11:Ac3H11_1083
MLRFLNSLFGRVILALIAGVAIGLLWPDTAVQLKPLGDGFIKLIKMLIPLIVFCVVVHGI
AGTGDLKRVGRVGIKSLIYFEVVTTIALVLGLALAFWFEPGVGMNVDPKALDPKAMGAYA
DNASKLTGGGFSDFLLKLIPTTAVSAFANGDVLQVLLFSIVFGCALALMGDRGARVTGLI
EDLSHVLFKTMGLIIKLAPLGVLGAIAFTVGKYGIGSLKQLGMLVVLFYAAVFIFVVVVL
GLIMRVSGFSLFKLLRYLREELAVVFATTSSDSVLPQIMAKLKHMGIRDSTVGLVIPTGY
SFNLDAFSIYITLAAVFIAQATNTPITMTDLLTILAISLVTSKGAHGVPGSAIVVLAATL
HAIPAIPAIGLVLVLSVDWFMGIARALGNLIGNCVATVAIAAWEGDIDRDRAHAVLDGQS
LPPLQPPLQPSPAQPQPAPQSAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory