Comparing Ac3H11_1109 ABC transporter ATP-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
35% identity, 93% coverage: 2:479/513 of query aligns to 9:485/501 of P04983
3d31A Modbc from methanosarcina acetivorans (see paper)
36% identity, 39% coverage: 14:215/513 of query aligns to 17:214/348 of 3d31A
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 39% coverage: 9:207/513 of query aligns to 17:219/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
36% identity, 39% coverage: 9:207/513 of query aligns to 18:220/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
36% identity, 39% coverage: 9:207/513 of query aligns to 18:220/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
36% identity, 39% coverage: 9:207/513 of query aligns to 18:220/344 of 3tuiC
Sites not aligning to the query:
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
34% identity, 42% coverage: 1:215/513 of query aligns to 6:235/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
34% identity, 42% coverage: 1:215/513 of query aligns to 10:239/258 of P02915
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
33% identity, 42% coverage: 3:215/513 of query aligns to 7:222/240 of 4ymuJ
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 43% coverage: 3:222/513 of query aligns to 10:243/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 43% coverage: 3:222/513 of query aligns to 10:243/254 of 1g6hA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 39% coverage: 14:215/513 of query aligns to 19:222/241 of 4u00A
Sites not aligning to the query:
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
30% identity, 54% coverage: 2:277/513 of query aligns to 8:283/369 of P19566
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 43% coverage: 3:225/513 of query aligns to 9:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 43% coverage: 3:225/513 of query aligns to 9:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 43% coverage: 3:225/513 of query aligns to 9:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 43% coverage: 3:225/513 of query aligns to 9:242/242 of 2oljA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
33% identity, 40% coverage: 3:207/513 of query aligns to 9:217/229 of 6z67B
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
33% identity, 40% coverage: 3:207/513 of query aligns to 9:217/230 of 6z4wA
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
28% identity, 61% coverage: 1:311/513 of query aligns to 10:312/375 of 2d62A
>Ac3H11_1109 ABC transporter ATP-binding protein
VGITKRYPAVVANSGVSLTVLPGEIHAVLGENGAGKSTLMKIIYGSVKPDEGSVFFNGQA
VQVRNPQEARALGIAMVFQHFSLFDTLTVAENVWLGLDKSLTLAEVTQRISAKAAEYGLD
IDPLRPVHTLSVGEMQRVEIIRALLTNPKVLILDEPTSVLTPQAVEKLFVVLRKLASEGC
SILYISHKLHEIRALCTACTVLRGGKVTGVCNPSEETNASLSRLMIGAEPPALEHRAVQT
GATVLRVKGLSLPRADQFGVDLIDLQFEVKAGEVVGIAGVSGNGQKELLYALSGEDQRAE
PASIQVTGQNAGRMGPGQRRALGLHFVPEERLGRGAVPTMGLAHNLLLTRKNAVGGSGWI
KVGALQKHAEDIIQRFNVKAGGPHSAAKSLSGGNLQKFIVGREIDANPKLLIVSQPTWGV
DVGAAAQIRGSILALRDAGCAVLVVSEELDELFEICDRLHVVAKGRLSPSVQRAEATVER
IGEWMSGLWHADVQAHLAQQQQQQNRAGEVQHA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory