Comparing Ac3H11_112 FitnessBrowser__acidovorax_3H11:Ac3H11_112 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
29% identity, 56% coverage: 131:322/345 of query aligns to 87:279/302 of 8hkbA
Sites not aligning to the query:
2dvzA Structure of a periplasmic transporter (see paper)
24% identity, 60% coverage: 125:331/345 of query aligns to 87:285/300 of 2dvzA
Sites not aligning to the query:
>Ac3H11_112 FitnessBrowser__acidovorax_3H11:Ac3H11_112
MPSAPRPLPTLPRRHALQWLAALAGTSGAAHAPAAWAADASLEPAECIAPSRPGGGFDLT
CGLATQAVQVVRPARPPLHTRYLPGGIGAVAFDQVATGRLGGPGTLVAFSSGSLLNIAQG
RFGPHPVSAVRWIATLGTDYGVVAVHRDAPHQRLQDVVAALRKDPARVVFGAGGTLGSQD
WMKAALLTRAAGQDPKRMRFVSFEGGGEALKALRGGHIGVFTGDAAEARQALEKGAPLRF
LAVLAQARLPGALADLPTAREQGVDLVWPTVRGLYMAASAPDAAVRAWVTAFADALAAPG
YAALCGQYGLYPFARTGAALEAFVQRSLADYRQLAQELGLRSWPR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory