SitesBLAST
Comparing Ac3H11_1121 FitnessBrowser__acidovorax_3H11:Ac3H11_1121 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
4bv9A Crystal structure of the NADPH form of mouse mu-crystallin. (see paper)
35% identity, 80% coverage: 54:324/337 of query aligns to 37:296/303 of 4bv9A
- active site: G58 (≠ F74), S220 (≠ F242)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S82 (= S102), H83 (≠ I103), T111 (= T131), G134 (= G154), G136 (= G156), V137 (= V157), Q138 (= Q158), N159 (≠ S179), R160 (= R180), T161 (≠ S181), V195 (≠ C218), T196 (= T219), M197 (≠ T220), A198 (= A221), V217 (= V239), G218 (= G240), S283 (= S311), L284 (≠ C312), G285 (= G313)
- binding pyruvic acid: R45 (= R62), M60 (= M76), K73 (= K87), R110 (= R130)
4bvaA Crystal structure of the NADPH-t3 form of mouse mu-crystallin. (see paper)
34% identity, 80% coverage: 54:324/337 of query aligns to 38:295/303 of 4bvaA
- active site: G59 (≠ F74), S219 (≠ F242)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T106 (= T127), R109 (= R130), T110 (= T131), G135 (= G156), V136 (= V157), Q137 (= Q158), N158 (≠ S179), R159 (= R180), T160 (≠ S181), N163 (≠ S184), V194 (≠ C218), T195 (= T219), M196 (≠ T220), A197 (= A221), V216 (= V239), S282 (= S311), L283 (≠ C312), G284 (= G313)
- binding 3,5,3'triiodothyronine: R46 (= R62), F57 (≠ S72), G59 (≠ F74), V76 (≠ I89), F78 (= F91), S219 (≠ F242), R220 (≠ T243), W223 (≠ M246), E247 (= E273)
2i99A Crystal structure of human mu_crystallin at 2.6 angstrom (see paper)
34% identity, 79% coverage: 60:324/337 of query aligns to 44:304/312 of 2i99A
- active site: G59 (≠ F74), S228 (≠ F242)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: D81 (≠ A94), S90 (= S102), H91 (≠ I103), R118 (= R130), T119 (= T131), G142 (= G154), A143 (= A155), G144 (= G156), V145 (= V157), Q146 (= Q158), N167 (≠ S179), R168 (= R180), T169 (≠ S181), V203 (≠ C218), T204 (= T219), L205 (≠ T220), A206 (= A221), V225 (= V239), G226 (= G240), S291 (= S311), L292 (≠ C312), G293 (= G313)
Q14894 Ketimine reductase mu-crystallin; NADP-regulated thyroid-hormone-binding protein; EC 1.5.1.25 from Homo sapiens (Human) (see paper)
34% identity, 79% coverage: 60:324/337 of query aligns to 45:305/314 of Q14894
6t3eB Structure of thermococcus litoralis delta(1)-pyrroline-2-carboxylate reductase in complex with nadh and l-proline (see paper)
25% identity, 82% coverage: 52:328/337 of query aligns to 29:313/325 of 6t3eB
- binding 1,4-dihydronicotinamide adenine dinucleotide: S82 (= S102), T111 (= T131), G136 (= G156), V137 (= V157), Q138 (= Q158), D159 (≠ S179), I160 (≠ R180), A199 (≠ C218), T200 (= T219), T201 (= T220), A202 (= A221), V206 (= V225), V221 (= V239), G222 (= G240), W223 (≠ A241), S296 (= S311), V297 (≠ C312), G298 (= G313)
- binding proline: R39 (= R62), M54 (= M76), K67 (= K87), R110 (= R130)
Q9FLY0 Protein SAR DEFICIENT 4; Ornithine cyclodeaminase-like protein; AtOCD from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 71% coverage: 87:324/337 of query aligns to 71:316/325 of Q9FLY0
- G89 (= G105) mutation to E: In sard4-3; compromises systemic acquired resistance (SAR).
- G138 (= G154) mutation to D: In sard4-4; compromises systemic acquired resistance (SAR).
- S205 (≠ A217) mutation to N: In sard4-1; compromises systemic acquired resistance (SAR).
1x7dA Crystal structure analysis of ornithine cyclodeaminase complexed with NAD and ornithine to 1.6 angstroms (see paper)
27% identity, 77% coverage: 71:328/337 of query aligns to 52:309/340 of 1x7dA
- active site: E55 (≠ F74), D227 (≠ F242)
- binding nicotinamide-adenine-dinucleotide: T83 (≠ S102), R111 (= R130), T112 (= T131), G137 (= G156), A138 (≠ V157), Q139 (= Q158), D160 (≠ S178), T161 (≠ S179), V200 (≠ C218), T201 (= T219), A202 (≠ T220), I209 (≠ H227), V224 (= V239), G225 (= G240), D227 (≠ F242), K231 (≠ M246), S292 (= S311), V293 (≠ C312), G294 (= G313)
- binding L-ornithine: V53 (≠ S72), E55 (≠ F74), M57 (= M76), K68 (= K87), V70 (≠ I89), N71 (≠ T90), G72 (≠ F91), R111 (= R130), D227 (≠ F242), V293 (≠ C312)
Sites not aligning to the query:
1u7hA Structure and a proposed mechanism for ornithine cyclodeaminase from pseudomonas putida (see paper)
27% identity, 77% coverage: 71:328/337 of query aligns to 52:309/341 of 1u7hA
- active site: E55 (≠ F74), D227 (≠ F242)
- binding nicotinamide-adenine-dinucleotide: T83 (≠ S102), R111 (= R130), T112 (= T131), G137 (= G156), A138 (≠ V157), Q139 (= Q158), D160 (≠ S178), T161 (≠ S179), V200 (≠ C218), T201 (= T219), A202 (≠ T220), I209 (≠ H227), V224 (= V239), G225 (= G240), D227 (≠ F242), K231 (≠ M246), S292 (= S311), V293 (≠ C312), G294 (= G313)
Q88H32 Ornithine cyclodeaminase; OCD; EC 4.3.1.12 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
27% identity, 77% coverage: 71:328/337 of query aligns to 53:310/350 of Q88H32
Sites not aligning to the query:
5gzlA Cyclodeaminase_pa
31% identity, 50% coverage: 87:255/337 of query aligns to 81:253/357 of 5gzlA
- binding lysine: D240 (≠ F242)
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ F91), T97 (≠ S102), I98 (= I103), T126 (= T131), G151 (= G156), A152 (≠ V157), Q153 (= Q158), D174 (≠ S179), T175 (≠ R180), H179 (≠ S184), A212 (= A221), T213 (≠ S222), S214 (= S223), V222 (vs. gap), V237 (= V239), G238 (= G240), A239 (= A241), D240 (≠ F242), K244 (≠ M246)
Sites not aligning to the query:
5gziA Cyclodeaminase_pa
31% identity, 50% coverage: 87:255/337 of query aligns to 81:253/354 of 5gziA
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ F91), T97 (≠ S102), R125 (= R130), T126 (= T131), G151 (= G156), A152 (≠ V157), Q153 (= Q158), D174 (≠ S179), T175 (≠ R180), H179 (≠ S184), A212 (= A221), T213 (≠ S222), S214 (= S223), V215 (≠ L224), V237 (= V239), G238 (= G240), A239 (= A241)
- binding (2S)-piperidine-2-carboxylic acid: K81 (= K87), R125 (= R130), A239 (= A241)
Sites not aligning to the query:
5yu4A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
31% identity, 50% coverage: 87:255/337 of query aligns to 77:249/344 of 5yu4A
- binding 2,4-diaminobutyric acid: K77 (= K87), R121 (= R130)
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ F91), T93 (≠ S102), I94 (= I103), R121 (= R130), T122 (= T131), G147 (= G156), A148 (≠ V157), Q149 (= Q158), D170 (≠ S179), T171 (≠ R180), H175 (≠ S184), A208 (= A221), T209 (≠ S222), S210 (= S223), V211 (≠ L224), V218 (vs. gap), V233 (= V239), A235 (= A241)
Sites not aligning to the query:
5yu3A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
31% identity, 50% coverage: 87:255/337 of query aligns to 77:249/344 of 5yu3A
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ F91), T93 (≠ S102), I94 (= I103), T122 (= T131), G147 (= G156), A148 (≠ V157), Q149 (= Q158), D170 (≠ S179), T171 (≠ R180), A208 (= A221), T209 (≠ S222), S210 (= S223), V211 (≠ L224), V233 (= V239), A235 (= A241)
- binding proline: K77 (= K87), R121 (= R130)
Sites not aligning to the query:
1omoA Alanine dehydrogenase dimer w/bound NAD (archaeal) (see paper)
24% identity, 80% coverage: 69:336/337 of query aligns to 47:315/320 of 1omoA
- active site: R52 (≠ F74), D219 (≠ F242)
- binding nicotinamide-adenine-dinucleotide: T109 (= T131), G134 (= G156), T135 (≠ V157), Q136 (= Q158), Y156 (≠ W176), D157 (≠ I177), V158 (≠ S178), R159 (≠ S179), T195 (= T219), P196 (≠ T220), G217 (= G240), D219 (≠ F242), K223 (≠ M246), S290 (= S311), T291 (≠ C312), G292 (= G313)
O28608 Alanine dehydrogenase; AlaDH; EC 1.4.1.1 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
24% identity, 80% coverage: 69:336/337 of query aligns to 47:315/322 of O28608
A1B8Z0 Iminosuccinate reductase; EC 1.4.1.- from Paracoccus denitrificans (strain Pd 1222) (see paper)
28% identity, 72% coverage: 91:332/337 of query aligns to 71:316/320 of A1B8Z0
6rqaB Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
28% identity, 72% coverage: 91:332/337 of query aligns to 73:318/322 of 6rqaB
- binding Tb-Xo4: N76 (≠ A94)
- binding nicotinamide-adenine-dinucleotide: T113 (= T131), G138 (= G156), Q140 (= Q158), P162 (vs. gap), H163 (vs. gap), I199 (≠ A217), T200 (≠ C218), S201 (≠ T219), S202 (≠ T220), M221 (≠ V239), G222 (= G240), D224 (≠ F242), K228 (≠ M246), G293 (≠ S311), T294 (≠ C312), G295 (= G313)
Sites not aligning to the query:
6rqaA Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
28% identity, 72% coverage: 91:332/337 of query aligns to 73:318/322 of 6rqaA
- binding nicotinamide-adenine-dinucleotide: H85 (≠ I103), T113 (= T131), G138 (= G156), H139 (≠ V157), Q140 (= Q158), N161 (vs. gap), P162 (vs. gap), H163 (vs. gap), M166 (≠ I177), I199 (≠ A217), T200 (≠ C218), S201 (≠ T219), S202 (≠ T220), M221 (≠ V239), G222 (= G240), D224 (≠ F242), K228 (≠ M246), G293 (≠ S311)
Query Sequence
>Ac3H11_1121 FitnessBrowser__acidovorax_3H11:Ac3H11_1121
LPPPNSPETLAAVYSQAMSFAPSTLAAGTLDAAATAQRLPWSALADEIAQLLHDSTVSVP
ARSVLPLAQGGSLFLMPATDRSVAMTKLITFTPANAGTGRPSIQGDVVVFDIATGARQLV
LDGPTVTARRTAAVSLLAARHLAPAPQGPLLIVGAGVQGLAHAEAFVLGLGVQEVWISSR
SAASAEALATQVRALGAQVRVVADADAALAHCPLVAACTTASSLVLHATPRADAFITAVG
AFTPAMAELAPALCQHVAEHGRIVVDTADASHEAGDLLQAGLDVAALPVLRDVVCGPWTP
RAPAGPVLFKSCGWAGWDLAAARLALRQGAAQPPSST
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory