SitesBLAST
Comparing Ac3H11_1156 FitnessBrowser__acidovorax_3H11:Ac3H11_1156 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q1LK00 Tryptophan 2,3-dioxygenase; TDO; Tryptamin 2,3-dioxygenase; Tryptophan oxygenase; TO; TRPO; Tryptophan pyrrolase; Tryptophanase; EC 1.13.11.11 from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans) (see paper)
67% identity, 100% coverage: 2:298/298 of query aligns to 7:299/299 of Q1LK00
- F68 (= F64) mutation to A: Abolishes catalytic activity.
- Y130 (= Y129) mutation to F: 15-fold increase in catalytic activity.
- R134 (= R133) mutation to A: Abolishes catalytic activity.
- T271 (= T270) mutation to A: Abolishes catalytic activity.
2noxB Crystal structure of tryptophan 2,3-dioxygenase from ralstonia metallidurans (see paper)
69% identity, 91% coverage: 29:298/298 of query aligns to 4:266/266 of 2noxB
- binding protoporphyrin ix containing fe: F39 (= F64), H43 (= H68), T46 (≠ S71), W90 (= W118), L93 (= L121), S112 (= S140), G113 (= G141), F114 (= F142), Y119 (= Y147), R120 (= R148), H228 (= H256), V232 (= V260), E242 (≠ T270), Y246 (= Y278), L247 (= L279)
Q8PDA8 Tryptophan 2,3-dioxygenase; TDO; Tryptamin 2,3-dioxygenase; Tryptophan oxygenase; TO; TRPO; Tryptophan pyrrolase; Tryptophanase; EC 1.13.11.11 from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see 2 papers)
49% identity, 90% coverage: 32:298/298 of query aligns to 17:282/298 of Q8PDA8
- FIIQH 51:55 (≠ FIVQH 64:68) binding
- H55 (= H68) mutation to A: Decrease in catalytic efficiency using L-tryptophan, 5-fluoro-D/L-tryptophan, 6-fluoro-D/L-tryptophan, 5-methyl-D/L-tryptophan and 6-methyl-D/L-tryptophan as substrate.; mutation to S: Decrease in catalytic efficiency using L-tryptophan, 5-fluoro-D/L-tryptophan, 6-fluoro-D/L-tryptophan, 5-methyl-D/L-tryptophan and 6-methyl-D/L-tryptophan as substrate.
- Y113 (= Y129) binding
- R117 (= R133) binding
- H240 (= H256) binding axial binding residue
- T254 (= T270) binding
2nw9A Crystal structure of tryptophan 2,3-dioxygenase (tdo) from xanthomonas campestris in complex with ferrous heme and 6-fluoro-tryptophan. Northeast structural genomics target xcr13 (see paper)
49% identity, 88% coverage: 37:298/298 of query aligns to 3:263/265 of 2nw9A
- binding 6-fluoro-l-tryptophan: F32 (= F64), H36 (= H68), Y94 (= Y129), R98 (= R133), L101 (= L136), S104 (= S139), G234 (= G269), T235 (= T270)
- binding protoporphyrin ix containing fe: F32 (= F64), H36 (= H68), S39 (= S71), W83 (= W118), L86 (= L121), G106 (= G141), F107 (= F142), Y112 (= Y147), R113 (= R148), H221 (= H256), V225 (= V260), I229 (= I264), G234 (= G269), G236 (= G271), S238 (≠ T273)
7p46A Crystal structure of xanthomonas campestris tryptophan 2,3-dioxygenase (tdo) (see paper)
48% identity, 90% coverage: 32:298/298 of query aligns to 13:278/281 of 7p46A
- binding protoporphyrin ix containing fe: S51 (≠ H68), S54 (= S71), W98 (= W118), S120 (= S140), G121 (= G141), F122 (= F142), Y127 (= Y147), R128 (= R148), H236 (= H256), V240 (= V260), G249 (= G269), G251 (= G271), S253 (≠ T273)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: F47 (= F64), S51 (≠ H68), Y109 (= Y129), R113 (= R133), S119 (= S139), G249 (= G269), T250 (= T270)
- binding tryptophan: K82 (= K102), A85 (= A105), Y216 (= Y236), S217 (≠ Q237), E220 (= E240), D224 (= D244)
1yw0A Crystal structure of the tryptophan 2,3-dioxygenase from xanthomonas campestris. Northeast structural genomics target xcr13.
45% identity, 88% coverage: 38:298/298 of query aligns to 1:241/243 of 1yw0A
P20351 Tryptophan 2,3-dioxygenase; TDO; Protein vermilion; Tryptamin 2,3-dioxygenase; Tryptophan oxygenase; TO; TRPO; Tryptophan pyrrolase; Tryptophanase; EC 1.13.11.11 from Drosophila melanogaster (Fruit fly) (see paper)
31% identity, 95% coverage: 2:283/298 of query aligns to 3:340/379 of P20351
- D123 (≠ E128) mutation to A: Strongly reduced enzyme activity.
- Y236 (vs. gap) mutation to F: Strongly reduced enzyme activity.
- R309 (= R253) mutation to A: Strongly reduced enzyme activity.
- H312 (= H256) binding axial binding residue
- Y335 (= Y278) mutation to F: Strongly reduced enzyme activity.
4hkaA Crystal structure of drosophila melanogaster tryptophan 2,3- dioxygenase in complex with heme (see paper)
32% identity, 82% coverage: 39:283/298 of query aligns to 4:317/345 of 4hkaA
- binding protoporphyrin ix containing fe: H38 (= H68), Y41 (≠ S71), F45 (≠ M75), L93 (= L121), F101 (≠ Y129), F114 (= F142), Q115 (= Q143), F119 (≠ Y147), Y136 (vs. gap), W285 (= W252), H289 (= H256), V293 (= V260), Y312 (= Y278), L313 (= L279)
5ti9C Crystal structure of human tdo in complex with trp and dioxygen, northeast structural genomics consortium target hr6161 (see paper)
29% identity, 88% coverage: 37:298/298 of query aligns to 1:307/326 of 5ti9C
- binding protoporphyrin ix containing fe: H37 (= H68), Y40 (≠ S71), L93 (= L121), S112 (= S140), G113 (= G141), F114 (= F142), F119 (≠ Y147), R120 (= R148), W259 (= W252), H263 (= H256), V267 (= V260), M270 (≠ V263), G276 (= G269), G278 (= G271), S280 (≠ T273), L286 (= L279)
- binding N'-Formylkynurenine: F33 (= F64), H37 (= H68), R105 (= R133), L108 (= L136), A111 (≠ S139), S112 (= S140), G113 (= G141), L271 (≠ I264), G276 (= G269), T277 (= T270)
- binding tryptophan: R64 (≠ G95), E66 (≠ R97), W159 (≠ A178), R162 (vs. gap), T163 (= T181), P164 (= P182), I230 (vs. gap), F239 (≠ Y232), P242 (≠ L235)
6pyzC Crystal structure of human tryptophan 2,3-dioxygenase in complex with pf-06840003 in active site (see paper)
30% identity, 88% coverage: 36:298/298 of query aligns to 1:314/333 of 6pyzC
- binding (3S)-3-(5-fluoro-1H-indol-3-yl)pyrrolidine-2,5-dione: Y4 (= Y39), Y7 (= Y42), F34 (= F64), H38 (= H68), A112 (≠ S139), S113 (= S140), T284 (= T270)
- binding protoporphyrin ix containing fe: H38 (= H68), Y41 (≠ S71), L94 (= L121), G114 (= G141), F115 (= F142), F120 (≠ Y147), R121 (= R148), H270 (= H256), M273 (≠ T259), V274 (= V260), M277 (≠ V263), G283 (= G269), G285 (= G271), S287 (≠ T273), Y292 (= Y278), L293 (= L279)
- binding alpha-methyl-L-tryptophan: R65 (≠ G95), E67 (≠ R97), W167 (≠ A178), R170 (vs. gap), T171 (= T181), P172 (= P182), F246 (≠ Y232)
P48775 Tryptophan 2,3-dioxygenase; TDO; Tryptamin 2,3-dioxygenase; Tryptophan oxygenase; TO; TRPO; Tryptophan pyrrolase; Tryptophanase; EC 1.13.11.11 from Homo sapiens (Human) (see 3 papers)
28% identity, 100% coverage: 2:298/298 of query aligns to 4:372/406 of P48775
- Y42 (= Y39) mutation to A: Reduces enzyme activity by 99%.
- Y45 (= Y42) mutation to A: Reduces enzyme activity by 99%.
- F72 (= F64) mutation to A: Abolishes enzyme activity.
- FIITH 72:76 (≠ FIVQH 64:68) binding
- H76 (= H68) mutation to A: Abolishes enzyme activity.
- M108 (≠ A100) to I: in HYPTRP; reduced tryptophan 2,3-dioxygenase activity; does not affect homotetramerization; dbSNP:rs1553957997
- F140 (≠ Y129) mutation to A: Reduces enzyme activity by 99%.
- R144 (= R133) binding ; mutation to A: Reduces enzyme activity by 99%.
- S151 (= S140) mutation to A: Reduces enzyme activity by 90%.
- Y175 (vs. gap) mutation to G: Reduces enzyme activity.
- H328 (= H256) binding axial binding residue; mutation to A: Abolishes enzyme activity.
- T342 (= T270) binding
6pyzA Crystal structure of human tryptophan 2,3-dioxygenase in complex with pf-06840003 in active site (see paper)
28% identity, 88% coverage: 36:298/298 of query aligns to 1:334/353 of 6pyzA
- binding (3S)-3-(5-fluoro-1H-indol-3-yl)pyrrolidine-2,5-dione: Y4 (= Y39), Y7 (= Y42), F34 (= F64), H38 (= H68), R106 (= R133), A112 (≠ S139), S113 (= S140), T304 (= T270)
- binding protoporphyrin ix containing fe: F34 (= F64), H38 (= H68), Y41 (≠ S71), L94 (= L121), F102 (≠ Y129), S113 (= S140), G114 (= G141), F115 (= F142), F120 (≠ Y147), R121 (= R148), H290 (= H256), M293 (≠ T259), V294 (= V260), M297 (≠ V263), G303 (= G269), G305 (= G271), S307 (≠ T273), Y312 (= Y278), L313 (= L279)
- binding alpha-methyl-L-tryptophan: R65 (≠ G95), E67 (≠ R97), W170 (≠ A178), R173 (vs. gap), T174 (= T181), P175 (= P182), F266 (≠ Y232), P269 (≠ L235)
5ti9A Crystal structure of human tdo in complex with trp and dioxygen, northeast structural genomics consortium target hr6161 (see paper)
28% identity, 88% coverage: 36:298/298 of query aligns to 1:334/350 of 5ti9A
- binding protoporphyrin ix containing fe: F34 (= F64), H38 (= H68), Y41 (≠ S71), F102 (≠ Y129), S113 (= S140), G114 (= G141), F115 (= F142), F120 (≠ Y147), R121 (= R148), W286 (= W252), H290 (= H256), M293 (≠ T259), V294 (= V260), G303 (= G269), G305 (= G271), S307 (≠ T273), L313 (= L279)
- binding tryptophan: F34 (= F64), H38 (= H68), R65 (≠ G95), E67 (≠ R97), F102 (≠ Y129), R106 (= R133), L109 (= L136), A112 (≠ S139), S113 (= S140), W170 (≠ A178), R173 (vs. gap), T174 (= T181), P175 (= P182), F266 (≠ Y232), P269 (≠ L235), G303 (= G269), T304 (= T270)
6vbnA Crystal structure of htdo2 bound to inhibitor gne1 (see paper)
29% identity, 87% coverage: 39:298/298 of query aligns to 3:333/344 of 6vbnA
- binding protoporphyrin ix containing fe: H37 (= H68), Y40 (≠ S71), L93 (= L121), F101 (≠ Y129), S112 (= S140), G113 (= G141), F114 (= F142), F119 (≠ Y147), R120 (= R148), W285 (= W252), H289 (= H256), V293 (= V260), M296 (≠ V263), L297 (≠ I264), Y311 (= Y278), L312 (= L279)
- binding 1,5-anhydro-2,3-dideoxy-3-[(5S)-5H-imidazo[5,1-a]isoindol-5-yl]-D-threo-pentitol: Y3 (= Y39), Y6 (= Y42), F33 (= F64), H37 (= H68), L108 (= L136), A111 (≠ S139), G113 (= G141)
Q09474 Tryptophan 2,3-dioxygenase; TDO; Tryptamin 2,3-dioxygenase; Tryptophan oxygenase; TO; TRPO; Tryptophan pyrrolase; Tryptophanase; EC 1.13.11.11 from Caenorhabditis elegans (see paper)
28% identity, 87% coverage: 38:296/298 of query aligns to 38:369/403 of Q09474
- PLD 133:135 (≠ PPE 126:128) PLD motif; required for enzymatic activity; mutation Missing: Abolishes catalytic activity. Animals have an extended lifespan, an extended reproductive lifespan, have fewer hatched progeny and display increased motility.
6a4iD Crystal structure of human tdo inhibitor complex
32% identity, 78% coverage: 37:267/298 of query aligns to 1:250/290 of 6a4iD
- binding 1-(6-chloro-1H-indazol-4-yl)cyclohexan-1-ol: Y3 (= Y39), Y6 (= Y42), F33 (= F64), H37 (= H68), A111 (≠ S139)
- binding protoporphyrin ix containing fe: F33 (= F64), H37 (= H68), Y40 (≠ S71), F101 (≠ Y129), S112 (= S140), G113 (= G141), F114 (= F142), F119 (≠ Y147), H239 (= H256), V243 (= V260), M246 (≠ V263)
- binding tryptophan: R64 (≠ G95), W153 (≠ A178), R156 (vs. gap), T157 (= T181), P158 (= P182), I206 (≠ L223), F215 (≠ Y232)
Sites not aligning to the query:
8qv7B Crystal structure of human tdo with alpha-methyl-l-tryptophan
30% identity, 77% coverage: 37:265/298 of query aligns to 1:272/310 of 8qv7B
Sites not aligning to the query:
6a4iA Crystal structure of human tdo inhibitor complex
28% identity, 87% coverage: 39:298/298 of query aligns to 3:313/322 of 6a4iA
- binding 1-(6-chloro-1H-indazol-4-yl)cyclohexan-1-ol: Y3 (= Y39), Y6 (= Y42), F33 (= F64), H37 (= H68), A111 (≠ S139)
- binding protoporphyrin ix containing fe: F33 (= F64), H37 (= H68), Y40 (≠ S71), L93 (= L121), F101 (≠ Y129), S112 (= S140), G113 (= G141), F114 (= F142), F119 (≠ Y147), W270 (= W252), H274 (= H256), M277 (≠ T259), V278 (= V260), M281 (≠ V263), L292 (= L279)
- binding tryptophan: R64 (≠ G95), W158 (≠ A178), R161 (vs. gap), T162 (= T181), P163 (= P182), I241 (≠ L223), F250 (≠ Y232), P253 (≠ L235)
6a4iB Crystal structure of human tdo inhibitor complex
29% identity, 88% coverage: 37:298/298 of query aligns to 1:295/309 of 6a4iB
- binding 1-(6-chloro-1H-indazol-4-yl)cyclohexan-1-ol: Y3 (= Y39), Y6 (= Y42), F33 (= F64), H37 (= H68), L108 (= L136), A111 (≠ S139)
- binding protoporphyrin ix containing fe: F33 (= F64), H37 (= H68), Y40 (≠ S71), L93 (= L121), S112 (= S140), G113 (= G141), F114 (= F142), F119 (≠ Y147), R120 (= R148), W255 (= W252), H259 (= H256), V263 (= V260), L274 (= L279)
- binding tryptophan: R64 (≠ G95), E66 (≠ R97), W153 (≠ A178), R156 (vs. gap), T157 (= T181), P158 (= P182), P238 (≠ L235)
8r5qC Structure of apo tdo with a bound inhibitor
29% identity, 77% coverage: 37:265/298 of query aligns to 1:282/317 of 8r5qC
- binding 3-chloranyl-~{N}-[(1~{S})-1-(6-chloranylpyridin-3-yl)-2-phenyl-ethyl]aniline: Y3 (= Y39), Y6 (= Y42), L7 (= L43), F33 (= F64), H37 (= H68), F101 (≠ Y129), P110 (≠ S138), G113 (= G141), Q115 (= Q143), S116 (= S144), H273 (= H256), V277 (= V260), M280 (≠ V263)
- binding alpha-methyl-L-tryptophan: R64 (≠ G95), E66 (≠ R97), W153 (≠ A178), R156 (vs. gap), P158 (= P182), F249 (≠ Y232)
Query Sequence
>Ac3H11_1156 FitnessBrowser__acidovorax_3H11:Ac3H11_1156
MCPFSHTPAPANEAPGTALPESIVHEERAQLDFSKSMSYGDYLQLDAILTAQKPLSPAHD
EMLFIVQHQTSELWMKLMLHELRAAIDRIANPDTGTRAEAFKMLARVSRIMEQLVSAWSV
LATMTPPEYTAMRPYLASSSGFQSYQYRAIEFSLGNKNAAMLKPHEHRPDLLAQVRSAYE
TPSLYDVSLQLLAKEGLHIPASHLERDWTQPYMESEAVKEAWLAVYRDPQKYWDLYQLGE
KLTDIEDAFRLWRFRHVTTVERVIGFKRGTGGTGGVSYLRKMLDVVLFPEIWKLRTDL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory