Comparing Ac3H11_1157 FitnessBrowser__acidovorax_3H11:Ac3H11_1157 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P83788 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Pseudomonas fluorescens (see paper)
60% identity, 100% coverage: 3:436/436 of query aligns to 2:416/416 of P83788
1qz9A The three dimensional structure of kynureninase from pseudomonas fluorescens (see paper)
60% identity, 97% coverage: 3:424/436 of query aligns to 1:403/404 of 1qz9A
P70712 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Rattus norvegicus (Rat) (see paper)
27% identity, 95% coverage: 11:423/436 of query aligns to 33:462/464 of P70712
Sites not aligning to the query:
2hzpA Crystal structure of homo sapiens kynureninase (see paper)
27% identity, 94% coverage: 11:421/436 of query aligns to 28:447/447 of 2hzpA
Q16719 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Homo sapiens (Human) (see 4 papers)
27% identity, 95% coverage: 11:423/436 of query aligns to 33:462/465 of Q16719
Sites not aligning to the query:
3e9kA Crystal structure of homo sapiens kynureninase-3-hydroxyhippuric acid inhibitor complex (see paper)
27% identity, 94% coverage: 11:421/436 of query aligns to 28:446/446 of 3e9kA
3lvmB Crystal structure of e.Coli iscs (see paper)
26% identity, 43% coverage: 65:253/436 of query aligns to 51:238/394 of 3lvmB
Sites not aligning to the query:
P0A6B7 Cysteine desulfurase IscS; NifS protein homolog; ThiI transpersulfidase; TusA transpersulfidase; EC 2.8.1.7 from Escherichia coli (strain K12) (see 4 papers)
26% identity, 43% coverage: 65:253/436 of query aligns to 45:232/404 of P0A6B7
Sites not aligning to the query:
P0A6B9 Cysteine desulfurase IscS; EC 2.8.1.7 from Escherichia coli O157:H7 (see paper)
26% identity, 43% coverage: 65:253/436 of query aligns to 45:232/404 of P0A6B9
Sites not aligning to the query:
5b7uA Apo structure of cysteine desulfurase from thermococcus onnurineus na1 at 1.89a (see paper)
24% identity, 51% coverage: 30:253/436 of query aligns to 22:248/402 of 5b7uA
Sites not aligning to the query:
5b87A Crystal structure of a cysteine desulfurase from thermococcus onnurineus na1 in complex with alanine at 2.3 angstrom resolution (see paper)
24% identity, 51% coverage: 30:253/436 of query aligns to 16:242/397 of 5b87A
Sites not aligning to the query:
5wgbA Crystal structure of the human mitochondrial cysteine desulfurase in complex with isd11 and e. Coli acp1 protein at 2.75a (see paper)
23% identity, 42% coverage: 61:242/436 of query aligns to 17:197/291 of 5wgbA
6nzuA Structure of the human frataxin-bound iron-sulfur cluster assembly complex (see paper)
23% identity, 41% coverage: 75:253/436 of query aligns to 49:229/402 of 6nzuA
Q9Y697 Cysteine desulfurase; EC 2.8.1.7 from Homo sapiens (Human) (see 5 papers)
23% identity, 41% coverage: 75:253/436 of query aligns to 104:284/457 of Q9Y697
Sites not aligning to the query:
Q9VKD3 Cysteine desulfurase, mitochondrial; EC 2.8.1.7 from Drosophila melanogaster (Fruit fly) (see paper)
22% identity, 44% coverage: 65:257/436 of query aligns to 102:292/462 of Q9VKD3
Sites not aligning to the query:
7tlpA Structure of atopobium parvulum sufs k235r (see paper)
26% identity, 33% coverage: 138:279/436 of query aligns to 126:279/391 of 7tlpA
Sites not aligning to the query:
7tlpB Structure of atopobium parvulum sufs k235r (see paper)
26% identity, 33% coverage: 138:279/436 of query aligns to 128:281/393 of 7tlpB
Sites not aligning to the query:
1vjoA Crystal structure of alanine--glyoxylate aminotransferase (alr1004) from nostoc sp. At 1.70 a resolution (see paper)
35% identity, 19% coverage: 154:236/436 of query aligns to 133:216/377 of 1vjoA
Sites not aligning to the query:
8odqD Sufs-sufu complex from mycobacterium tuberculosis (see paper)
28% identity, 44% coverage: 160:350/436 of query aligns to 161:340/410 of 8odqD
Sites not aligning to the query:
7tlmA Structure of atopobium parvulum sufs (see paper)
24% identity, 49% coverage: 24:238/436 of query aligns to 21:241/415 of 7tlmA
>Ac3H11_1157 FitnessBrowser__acidovorax_3H11:Ac3H11_1157
MTTTLQDCRALDAQDPLAPLHSHFALPPGVIYLDGNSLGVAPKAAAARVADVVTREWATD
LIKSWNTASWFDLPQRLGNQLAPLIGAGPNEVVCTDSTSINLYKVLSAALNIAREDSPAR
KRIVSERSNFPTDLYIAEGLCKERGLELVLVEPEEINAALTSDVAVLMLTHVNYRTGAMH
DMAAITAAAHAQGILCVWDLAHSAGAVPVDLNGAGADFSIGCGYKYLNGGPGAPAFVWVH
SRHASRFWQPLSGWWGHAAPFAFTPDYQPAPGITRYLCGTQPIISLSALQCGLDVFTAAQ
SLGGMAALRAKSLALTDLFIQLVEERCAGHGLGLATPREHAQRGSQVCLTRDEGAGVGGQ
GSGAYAIVQALIARGVIGDFRKGDGGTGRHKDILRFGFTPLYLGFEDVWNAVEHLRQVLE
SGEWQKAEFNQTHAVT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory