Comparing Ac3H11_1158 FitnessBrowser__acidovorax_3H11:Ac3H11_1158 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
Q9I234 Kynurenine formamidase; KFA; KFase; Arylformamidase; N-formylkynurenine formamidase; FKF; EC 3.5.1.9 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
58% identity, 97% coverage: 8:217/217 of query aligns to 2:209/213 of Q9I234
4cobA Crystal structure kynurenine formamidase from pseudomonas aeruginosa (see paper)
58% identity, 95% coverage: 11:217/217 of query aligns to 1:205/206 of 4cobA
B4E9I9 Kynurenine formamidase; KFA; KFase; Arylformamidase; N-formylkynurenine formamidase; FKF; EC 3.5.1.9 from Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) (Burkholderia cepacia (strain J2315)) (see paper)
57% identity, 95% coverage: 12:217/217 of query aligns to 4:208/213 of B4E9I9
4cogA Crystal structure of kynurenine formamidase from burkholderia cenocepacia (see paper)
57% identity, 95% coverage: 12:217/217 of query aligns to 2:206/207 of 4cogA
Q81PP9 Kynurenine formamidase; KFA; KFase; Arylformamidase; N-formylkynurenine formamidase; FKF; EC 3.5.1.9 from Bacillus anthracis (see paper)
37% identity, 93% coverage: 14:215/217 of query aligns to 8:207/209 of Q81PP9
4cz1A Crystal structure of kynurenine formamidase from bacillus anthracis complexed with 2-aminoacetophenone. (see paper)
37% identity, 93% coverage: 14:215/217 of query aligns to 6:205/207 of 4cz1A
4co9A Crystal structure of kynurenine formamidase from bacillus anthracis (see paper)
37% identity, 93% coverage: 14:215/217 of query aligns to 6:205/207 of 4co9A
1r61A The structure of predicted metal-dependent hydrolase from bacillus stearothermophilus
33% identity, 95% coverage: 9:214/217 of query aligns to 2:202/205 of 1r61A
8hmoA Crystal structure of metal-dependent hydrolase complexed with manganese from bacillus smithii
30% identity, 94% coverage: 11:214/217 of query aligns to 2:200/205 of 8hmoA
>Ac3H11_1158 FitnessBrowser__acidovorax_3H11:Ac3H11_1158
MSTPSSPTARRLWDISPPVHAGSPVFPGDTAYSQQWCATIGPGCPVNVSAITMSPHVGAH
ADAPLHYDAQGATIGDVSLDAFLGPCRVVHAIGCGPLITWEHIAHAVDGTLPQRVLVRTY
EHMPVDRWDGQLAAYAPGTIERLADLGVLLVGIDTASIDPADSKTLDSHQVIRRRGLRVL
ENLVLDAVPEGDYELIALPLKLTTADASPVRAVLRAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory