Comparing Ac3H11_1167 FitnessBrowser__acidovorax_3H11:Ac3H11_1167 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
3fijA Crystal structure of a uncharacterized protein lin1909
40% identity, 69% coverage: 34:236/296 of query aligns to 10:201/224 of 3fijA
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
31% identity, 77% coverage: 31:257/296 of query aligns to 23:242/252 of 6vtvB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
31% identity, 77% coverage: 31:257/296 of query aligns to 25:244/254 of P76038
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
34% identity, 64% coverage: 70:259/296 of query aligns to 62:250/255 of 7d50B
7d53A Spua mutant - h221n with glu (see paper)
35% identity, 64% coverage: 72:259/296 of query aligns to 58:244/249 of 7d53A
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 87% coverage: 2:258/296 of query aligns to 52:296/308 of O33341
7d4rB Spua native structure (see paper)
37% identity, 51% coverage: 110:259/296 of query aligns to 65:212/215 of 7d4rB
>Ac3H11_1167 FitnessBrowser__acidovorax_3H11:Ac3H11_1167
MPAAPRLKIGLSACFQHADPTRPLFTNKTLQYVEQSIAHWIMSSGAIVVMVPCPTGETAR
GDVTLQHYAEWLDGVVMHGGADVWPGNYGEEPLREEWVGDRVRDIYDLALVKAFAEVGKP
IFGVCRGLQLINVAFGGALYQDIETQHPGALQHRNATTYDQHFHGIQIVPDSHLAKLYPD
VPRARVNSIHHQGIKRVAPEFEVEALSEPDGVPEAIRLKPAPGRGYIAATQWHPEFHKKG
SDTLDDTAILQDFLAACAEARKNPVRPGQPVGLRDRATRLLKTALRKDRQRDKEGH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory