Comparing Ac3H11_1183 FitnessBrowser__acidovorax_3H11:Ac3H11_1183 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2gwgA Crystal structure of 4-oxalomesaconate hydratase, ligj, from rhodopseudomonas palustris, northeast structural genomics target rpr66.
80% identity, 99% coverage: 3:343/344 of query aligns to 1:325/329 of 2gwgA
G2IQQ5 2-keto-4-carboxy-3-hexenedioate hydratase; KCH hydratase; EC 4.2.1.- from Sphingobium sp. (strain NBRC 103272 / SYK-6) (see paper)
65% identity, 100% coverage: 1:344/344 of query aligns to 1:341/341 of G2IQQ5
6dxsA Crystal structure of the ligj hydratase e284q mutant substrate complex with (3z)-2-keto-4-carboxy-3-hexenedioate (see paper)
65% identity, 99% coverage: 3:344/344 of query aligns to 2:340/342 of 6dxsA
6dxqA Crystal structure of the ligj hydratase product complex with 4- carboxy-4-hydroxy-2-oxoadipate (see paper)
66% identity, 99% coverage: 4:344/344 of query aligns to 1:338/338 of 6dxqA
6e6iA Crystal structure of 4-methyl hopda bound to ligy from sphingobium sp. Strain syk-6
35% identity, 96% coverage: 3:333/344 of query aligns to 1:329/332 of 6e6iA
5vn5C Crystal structure of ligy from sphingobium sp. Strain syk-6 (see paper)
35% identity, 96% coverage: 3:333/344 of query aligns to 1:329/334 of 5vn5C
4infA Crystal structure of amidohydrolase saro_0799 (target efi-505250) from novosphingobium aromaticivorans dsm 12444 with bound calcium
24% identity, 73% coverage: 83:333/344 of query aligns to 99:350/351 of 4infA
Sites not aligning to the query:
4qrnA High-resolution crystal structure of 5-carboxyvanillate decarboxylase (target efi-505250) from novosphingobium aromaticivorans dsm 12444 complexed with manganese and 4-hydroxy-3-methoxy-5-nitrobenzoic acid
24% identity, 73% coverage: 83:333/344 of query aligns to 100:351/352 of 4qrnA
Sites not aligning to the query:
7pwyC Structure of human dimeric acmsd in complex with the inhibitor tes- 1025 (see paper)
23% identity, 76% coverage: 56:316/344 of query aligns to 49:296/301 of 7pwyC
Sites not aligning to the query:
Q12BV1 Gamma-resorcylate decarboxylase; Gamma-RSD; 2,6-dihydroxybenzoate decarboxylase; 2,6-DHBD; EC 4.1.1.103 from Polaromonas sp. (strain JS666 / ATCC BAA-500) (see paper)
27% identity, 55% coverage: 47:236/344 of query aligns to 31:229/326 of Q12BV1
Sites not aligning to the query:
4qroA Crystal structure of dihydroxybenzoic acid decarbboxylase bpro_2061 (target efi-500288) from polaromonas sp. Js666 with bound manganese and an inhibitor, 2-nitroresorcinol
27% identity, 55% coverage: 47:236/344 of query aligns to 31:229/332 of 4qroA
Sites not aligning to the query:
7pwyA Structure of human dimeric acmsd in complex with the inhibitor tes- 1025 (see paper)
21% identity, 76% coverage: 56:316/344 of query aligns to 58:325/334 of 7pwyA
Sites not aligning to the query:
4ih3A 2.5 angstroms x-ray crystal structure of of human 2-amino-3- carboxymuconate-6-semialdehyde decarboxylase in complex with dipicolinic acid (see paper)
21% identity, 76% coverage: 56:316/344 of query aligns to 59:326/332 of 4ih3A
Sites not aligning to the query:
2wm1A The crystal structure of human alpha-amino-beta-carboxymuconate- epsilon-semialdehyde decarboxylase in complex with 1,3- dihydroxyacetonephosphate suggests a regulatory link between NAD synthesis and glycolysis (see paper)
21% identity, 76% coverage: 56:316/344 of query aligns to 59:326/332 of 2wm1A
Sites not aligning to the query:
Q8TDX5 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase; Picolinate carboxylase; EC 4.1.1.45 from Homo sapiens (Human) (see paper)
21% identity, 76% coverage: 56:316/344 of query aligns to 59:326/336 of Q8TDX5
Sites not aligning to the query:
4ofcA 2.0 angstroms x-ray crystal structure of human 2-amino-3- carboxymuconate-6-semialdehye decarboxylase (see paper)
21% identity, 76% coverage: 56:316/344 of query aligns to 59:326/335 of 4ofcA
Sites not aligning to the query:
3ij6A Crystal structure of an uncharacterized metal-dependent hydrolase from lactobacillus acidophilus
24% identity, 71% coverage: 83:327/344 of query aligns to 66:296/303 of 3ij6A
Sites not aligning to the query:
Q60FX6 Gamma-resorcylate decarboxylase; 2,6-dihydroxybenzoate decarboxylase; Reversible gamma-RA decarboxylase; EC 4.1.1.103 from Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) (see paper)
25% identity, 83% coverage: 52:338/344 of query aligns to 39:327/327 of Q60FX6
2dvxA Crystal structure of 2,6-dihydroxybenzoate decarboxylase complexed with inhibitor 2,3-dihydroxybenzaldehyde
26% identity, 53% coverage: 52:232/344 of query aligns to 39:225/325 of 2dvxA
Sites not aligning to the query:
2dvuA Crystal structure of 2,6-dihydroxybenzoate decarboxylase complexed with 2,6-dihydroxybenzoate
26% identity, 53% coverage: 52:232/344 of query aligns to 39:225/325 of 2dvuA
Sites not aligning to the query:
>Ac3H11_1183 FitnessBrowser__acidovorax_3H11:Ac3H11_1183
MSLIIDCHGHYTTAPKALENWRNAQIAGIKDPSAMPKVADLHISDDELRESIETNQLKLM
KERGSDITLFSPRASFMAHHIGDFNVSSTWAAICNELCFRVSTLFPDHFVPVAMLPQSPG
VDPATCIPELEKCVHEYGAVGINLNPDPSGGHWTSPPLTDKHWYPIYEKMVEYDLPAMIH
VSTSCNACFHTTGAHYLNADTTAFMQLIQGDLFKDFPTLKFLIPHGGGAVPYHWGRFRGL
AQEMKKPLLDDHVMNNVFFDTCVYHQPGIDLLNTVIPVKNVLFASEMIGAVRGIDPTTGN
YYDDTKRYIEASTILSAEDKHQIYEANTRRVFSRLDTRLKAKGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory