Comparing Ac3H11_1207 FitnessBrowser__acidovorax_3H11:Ac3H11_1207 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 99% coverage: 1:270/272 of query aligns to 37:303/307 of Q94JV5
Sites not aligning to the query:
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
34% identity, 99% coverage: 1:269/272 of query aligns to 4:264/276 of Q9NQR4
4hgdA Structural insights into yeast nit2: c169s mutant of yeast nit2 in complex with an endogenous peptide-like ligand (see paper)
31% identity, 99% coverage: 2:269/272 of query aligns to 3:294/299 of 4hgdA
P47016 Deaminated glutathione amidase; dGSH amidase; Nitrilase homolog 1; EC 3.5.1.128 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
31% identity, 99% coverage: 2:269/272 of query aligns to 7:301/307 of P47016
4hg5A Structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate (see paper)
31% identity, 99% coverage: 2:269/272 of query aligns to 4:298/304 of 4hg5A
4hg3A Structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate (see paper)
31% identity, 99% coverage: 2:269/272 of query aligns to 4:298/304 of 4hg3A
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
30% identity, 89% coverage: 1:242/272 of query aligns to 1:224/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
30% identity, 89% coverage: 1:242/272 of query aligns to 1:224/261 of 3klcA
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
30% identity, 89% coverage: 1:242/272 of query aligns to 2:225/262 of Q9UYV8
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
29% identity, 88% coverage: 1:238/272 of query aligns to 9:228/269 of 6ypaB
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
29% identity, 88% coverage: 1:238/272 of query aligns to 3:222/263 of 7ovgA
4izuA The e41q mutant of the amidase from nesterenkonia sp. An1 showing the result of michael addition of acrylamide at the active site cysteine
34% identity, 58% coverage: 105:263/272 of query aligns to 104:249/254 of 4izuA
Sites not aligning to the query:
4iztA The e41q mutant of the amidase from nesterenkonia sp. An1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine
34% identity, 58% coverage: 105:263/272 of query aligns to 112:258/263 of 4iztA
5nycA A c145a mutant of nesterenkonia an1 amidase bound to propionitrile
30% identity, 85% coverage: 32:263/272 of query aligns to 41:256/261 of 5nycA
4izsA The c145a mutant of the amidase from nesterenkonia sp. An1 in complex with butyramide
30% identity, 85% coverage: 32:263/272 of query aligns to 41:256/261 of 4izsA
5nybA A c145a mutant of nesterenkonia an1 amidase bound to adipamide
30% identity, 85% coverage: 32:263/272 of query aligns to 41:257/262 of 5nybA
5ny7A A c145a mutant of nesterenkonia an1 amidase bound to nicotinamide
30% identity, 85% coverage: 32:263/272 of query aligns to 41:257/262 of 5ny7A
Sites not aligning to the query:
Q44185 N-carbamoyl-D-amino acid hydrolase; D-N-alpha-carbamilase; EC 3.5.1.77 from Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) (see paper)
26% identity, 88% coverage: 24:263/272 of query aligns to 31:286/304 of Q44185
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
22% identity, 95% coverage: 3:260/272 of query aligns to 7:270/297 of 5h8jB
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
22% identity, 95% coverage: 3:260/272 of query aligns to 11:274/301 of 5h8iC
>Ac3H11_1207 FitnessBrowser__acidovorax_3H11:Ac3H11_1207
MKVAAIQMVSGTQRDDNLRAARALLEEAALGGAELAVLPEYFCVMGHKDTDKLALREADG
DGVIQRFLADTARALKMWIVGGTLPLQTTAPDRVRNTTLVFSPTGDCVARYDKIHLFHFD
NGRELYDEGRVIEAGNTPVQFDLQARDGQRWRVGLSVCYDLRFPELYRAHARAGADLLLV
PSAFTHTTGQAHWEVLLRARAIENLAYVLAPAQGGVHENGRHTWGRSMLVDPWGTVLAQQ
DQGPGTVTGVLDAERLRAVRAQLPALTHRVLP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory