Comparing Ac3H11_1225 FitnessBrowser__acidovorax_3H11:Ac3H11_1225 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
7xntC Crystal structure of pfhppd-y13161 complex
38% identity, 85% coverage: 17:271/299 of query aligns to 5:247/320 of 7xntC
Sites not aligning to the query:
7x8eA Crystal structure of pfhppd-y13287 complex
38% identity, 85% coverage: 17:271/299 of query aligns to 5:255/341 of 7x8eA
Sites not aligning to the query:
7xntA Crystal structure of pfhppd-y13161 complex
38% identity, 85% coverage: 17:271/299 of query aligns to 6:262/341 of 7xntA
Sites not aligning to the query:
1cjxA Crystal structure of pseudomonas fluorescens hppd (see paper)
37% identity, 85% coverage: 17:271/299 of query aligns to 3:263/352 of 1cjxA
Sites not aligning to the query:
Q88JU3 3-dehydroshikimate dehydratase; DSD; EC 4.2.1.118 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
30% identity, 85% coverage: 22:275/299 of query aligns to 294:551/635 of Q88JU3
Sites not aligning to the query:
5hmqD Xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein
30% identity, 85% coverage: 22:275/299 of query aligns to 296:548/624 of 5hmqD
Sites not aligning to the query:
1t47A Structure of fe2-hppd bound to ntbc (see paper)
29% identity, 59% coverage: 95:271/299 of query aligns to 88:281/362 of 1t47A
Sites not aligning to the query:
7yvvA Acmp1, r-4-hydroxymandelate synthase
29% identity, 60% coverage: 92:271/299 of query aligns to 74:255/335 of 7yvvA
Sites not aligning to the query:
>Ac3H11_1225 FitnessBrowser__acidovorax_3H11:Ac3H11_1225
MSTPMVATREALGDMPNPLGLQGIEFIEYATSRPQALGQALERLGFQPVARHRSREVLLY
RQGDMNIIVNAHQDNERTGVHAPPALTETPVLAAIAFRVGNAAAAFRRVLELGAWAVHTE
VEVMELNIPAIHGVGASRIYFVDRWKEFSIYDVDFVPIPTVNPRPPALQGLHLFGVVQYI
GLGRAADWIHFYSELFGFAELAPDQSFGVLTHGRILASPCGTLHWQLIEPLVDALDADPE
ELLQRVAFGTPDVLATVQALRARGVEFVESPTGVHTGTRGALTRADAASPSFELVRSAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory