SitesBLAST
Comparing Ac3H11_1292 FitnessBrowser__acidovorax_3H11:Ac3H11_1292 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5wuwA Serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant (see paper)
63% identity, 96% coverage: 12:259/259 of query aligns to 1:245/245 of 5wuwA
- active site: G16 (= G27), S140 (= S154), Y154 (= Y168), L161 (≠ I175)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G23), R15 (= R26), I17 (= I28), Y36 (= Y47), A37 (≠ S48), A38 (≠ S49), D63 (= D74), S64 (= S75), N90 (= N101), A91 (= A102), G92 (= G103), Y154 (= Y168), K158 (= K172), G185 (= G199), P186 (= P200), V187 (= V201)
6j7uA Crystal structure of blue fluorescent protein from metagenomic library in complex with NADPH (see paper)
55% identity, 96% coverage: 12:259/259 of query aligns to 1:247/247 of 6j7uA
- active site: G16 (= G27), S142 (= S154), Y156 (= Y168)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G23), S14 (≠ A25), R15 (= R26), I17 (= I28), Y36 (= Y47), V37 (≠ S48), S38 (= S49), S41 (≠ A52), D65 (= D74), S66 (= S75), N92 (= N101), A93 (= A102), G94 (= G103), I115 (≠ V124), G141 (= G153), S142 (= S154), Y156 (= Y168), K160 (= K172), P186 (= P198), T191 (= T203), M193 (= M205), N194 (= N206)
5u2wA Crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP
58% identity, 94% coverage: 14:256/259 of query aligns to 4:243/246 of 5u2wA
- active site: G17 (= G27), S141 (= S154), M152 (≠ F165), Y155 (= Y168), K159 (= K172)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G23), S15 (≠ A25), R16 (= R26), G17 (= G27), I18 (= I28), Y37 (= Y47), E38 (≠ S48), K39 (≠ S49), S40 (= S50), A63 (= A73), D64 (= D74), S65 (= S75), N91 (= N101), A92 (= A102), G93 (= G103), T139 (≠ I152), Y155 (= Y168), K159 (= K172), P185 (= P198), G186 (= G199), T188 (≠ V201), T190 (= T203), M192 (= M205), N193 (= N206)
P39333 Cyclic-di-GMP-binding biofilm dispersal mediator protein from Escherichia coli (strain K12) (see paper)
50% identity, 95% coverage: 14:259/259 of query aligns to 4:237/237 of P39333
- E50 (= E62) mutation E->Q,V: Shows higher affinity for cyclic-di-GMP, increases swimming motility and biofilm dispersal. Biofilm formation is almost completely removed.
5z2lK Crystal structure of bdca in complex with NADPH (see paper)
50% identity, 95% coverage: 14:259/259 of query aligns to 3:236/244 of 5z2lK
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S14 (≠ A25), R15 (= R26), I17 (= I28), Y36 (= Y47), A37 (≠ S48), G38 (≠ S49), S39 (= S50), T57 (≠ A73), D58 (= D74), S59 (= S75), N81 (= N101), A82 (= A102), G83 (= G103), I129 (= I152), S131 (= S154), Y145 (= Y168), K149 (= K172), P175 (= P198), I178 (≠ V201), T180 (= T203), A182 (≠ M205), N183 (= N206)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
40% identity, 95% coverage: 13:257/259 of query aligns to 8:252/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G23), S20 (≠ A25), K21 (≠ R26), G22 (= G27), I23 (= I28), A43 (≠ S48), S44 (= S49), S45 (= S50), G68 (≠ A73), D69 (= D74), V70 (≠ S75), N96 (= N101), S97 (≠ A102), G98 (= G103), Y100 (≠ A105), I144 (= I152), S146 (= S154), Y159 (= Y168), K163 (= K172), P189 (= P198), G190 (= G199), M191 (≠ P200), I192 (≠ V201), T194 (= T203), G196 (≠ M205), T197 (≠ N206)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S154), Y159 (= Y168), M191 (≠ P200), I202 (≠ P211)
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
41% identity, 93% coverage: 17:257/259 of query aligns to 3:253/256 of Q48436
- 6:33 (vs. 20:48, 55% identical) binding
- D59 (= D74) binding
- K156 (= K172) binding
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
41% identity, 93% coverage: 17:257/259 of query aligns to 3:253/256 of 1gegE
- active site: G13 (= G27), S139 (≠ T155), Y152 (= Y168), K156 (= K172), V197 (vs. gap)
- binding alpha-D-glucopyranose: R63 (≠ A78), D64 (≠ A79), F67 (≠ T82), E123 (≠ R138)
- binding nicotinamide-adenine-dinucleotide: G9 (= G23), Q12 (≠ R26), I14 (= I28), D33 (≠ S48), Y34 (≠ S49), V58 (≠ A73), D59 (= D74), V60 (≠ S75), N86 (= N101), A87 (= A102), I109 (≠ V124), S139 (≠ T155), Y152 (= Y168), K156 (= K172), P182 (= P198), V185 (= V201), T187 (= T203), M189 (= M205)
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
32% identity, 95% coverage: 11:256/259 of query aligns to 2:249/261 of 1g6kA
- active site: G18 (= G27), S145 (= S154), Y158 (= Y168), K162 (= K172)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ R26), G18 (= G27), L19 (≠ I28), R39 (≠ S48), D65 (= D74), V66 (≠ S75), N92 (= N101), A93 (= A102), G94 (= G103), M143 (≠ I152), S145 (= S154), Y158 (= Y168), P188 (= P198), G189 (= G199), I191 (≠ V201), T193 (= T203)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
32% identity, 95% coverage: 11:256/259 of query aligns to 2:249/261 of P40288
- 11:35 (vs. 20:44, 32% identical) binding
- E96 (≠ A105) mutation E->A,G,K: Heat stable.
- D108 (= D117) mutation to N: Heat stable.
- V112 (≠ T121) mutation to A: Heat stable.
- E133 (≠ Q142) mutation to K: Heat stable.
- V183 (= V193) mutation to I: Heat stable.
- P194 (≠ D204) mutation to Q: Heat stable.
- E210 (≠ H217) mutation to K: Heat stable.
- Y217 (≠ R224) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
3wyeA Crystal structure of chimeric engineered (2s,3s)-butanediol dehydrogenase complexed with NAD+
40% identity, 93% coverage: 17:256/259 of query aligns to 2:251/255 of 3wyeA
- active site: G12 (= G27), S138 (= S154), Y151 (= Y168), K155 (= K172), L196 (≠ M205)
- binding nicotinamide-adenine-dinucleotide: G8 (= G23), Q11 (≠ R26), G12 (= G27), I13 (= I28), D32 (≠ S48), Y33 (≠ S49), V57 (≠ A73), D58 (= D74), V59 (≠ S75), N85 (= N101), A86 (= A102), S138 (= S154), Y151 (= Y168), K155 (= K172), P181 (= P198), G182 (= G199), V184 (= V201), T186 (= T203), M188 (vs. gap), W189 (vs. gap)
3iccA Crystal structure of a putative 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis at 1.87 a resolution (see paper)
38% identity, 94% coverage: 14:256/259 of query aligns to 5:252/255 of 3iccA
- active site: G18 (= G27), S148 (= S154), F158 (= F165), Y161 (= Y168), K165 (= K172)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G23), S16 (≠ A25), R17 (= R26), G18 (= G27), I19 (= I28), H37 (≠ T46), Y38 (= Y47), G39 (≠ S48), L66 (≠ S75), E67 (≠ A76), N98 (= N101), G100 (= G103), I146 (= I152), S148 (= S154), Y161 (= Y168), K165 (= K172), P191 (= P198), G192 (= G199), M198 (= M205), N199 (= N206)
4fj1B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and genistein (see paper)
35% identity, 94% coverage: 14:256/259 of query aligns to 5:257/259 of 4fj1B
- active site: G18 (= G27), S142 (= S154), N143 (≠ T155), H153 (≠ F165), Y156 (= Y168), K160 (= K172), Y201 (vs. gap)
- binding genistein: G188 (≠ P200), F194 (≠ N206), S198 (vs. gap), Y201 (vs. gap), I202 (vs. gap), M216 (= M220), A217 (= A221)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G23), R17 (= R26), G18 (= G27), I19 (= I28), A39 (≠ S48), N40 (≠ S49), S41 (= S50), I66 (≠ S75), N92 (= N101), S93 (≠ A102), G94 (= G103), L115 (≠ V124), T140 (≠ I152), S142 (= S154), Y156 (= Y168), K160 (= K172), G187 (= G199), T189 (≠ V201), T191 (= T203), M193 (= M205)
4fj2B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and biochanin a (see paper)
35% identity, 94% coverage: 14:256/259 of query aligns to 6:258/260 of 4fj2B
- active site: G19 (= G27), S143 (= S154), N144 (≠ T155), H154 (≠ F165), Y157 (= Y168), K161 (= K172), Y202 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G23), R18 (= R26), G19 (= G27), I20 (= I28), A40 (≠ S48), N41 (≠ S49), S42 (= S50), I67 (≠ S75), N93 (= N101), S94 (≠ A102), G95 (= G103), L116 (≠ V124), T141 (≠ I152), Y157 (= Y168), K161 (= K172), G188 (= G199), G189 (≠ P200), T190 (≠ V201), T192 (= T203), M194 (= M205)
- binding 5,7-dihydroxy-3-(4-methoxyphenyl)-4H-chromen-4-one: G189 (≠ P200), F195 (≠ N206), V198 (vs. gap), S199 (vs. gap), Y202 (vs. gap), I203 (vs. gap), M217 (= M220), A218 (= A221)
3qwiA Crystal structure of a 17beta-hydroxysteroid dehydrogenase (holo form) from fungus cochliobolus lunatus in complex with NADPH and coumestrol (see paper)
35% identity, 94% coverage: 14:256/259 of query aligns to 6:258/260 of 3qwiA
- active site: G19 (= G27), S143 (= S154), N144 (≠ T155), H154 (≠ F165), Y157 (= Y168), K161 (= K172), Y202 (vs. gap)
- binding Coumestrol: F149 (≠ V160), G189 (≠ P200), M194 (= M205), Y202 (vs. gap), I203 (vs. gap), A218 (= A221)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G23), R18 (= R26), I20 (= I28), A40 (≠ S48), N41 (≠ S49), S42 (= S50), I67 (≠ S75), N93 (= N101), S94 (≠ A102), G95 (= G103), L116 (≠ V124), T141 (≠ I152), Y157 (= Y168), K161 (= K172), P187 (= P198), G188 (= G199), G189 (≠ P200), T190 (≠ V201), T192 (= T203), M194 (= M205)
3qwhA Crystal structure of the 17beta-hydroxysteroid dehydrogenase from cochliobolus lunatus in complex with NADPH and kaempferol (see paper)
35% identity, 94% coverage: 14:256/259 of query aligns to 6:258/260 of 3qwhA
- active site: G19 (= G27), S143 (= S154), N144 (≠ T155), H154 (≠ F165), Y157 (= Y168), K161 (= K172), Y202 (vs. gap)
- binding 3,5,7-trihydroxy-2-(4-hydroxyphenyl)-4h-chromen-4-one: N144 (≠ T155), F149 (≠ V160), G189 (≠ P200), F195 (≠ N206), S199 (vs. gap), Y202 (vs. gap), I203 (vs. gap), A218 (= A221)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G23), R18 (= R26), G19 (= G27), I20 (= I28), A40 (≠ S48), N41 (≠ S49), S42 (= S50), D66 (= D74), I67 (≠ S75), N93 (= N101), S94 (≠ A102), G95 (= G103), L116 (≠ V124), T141 (≠ I152), Y157 (= Y168), K161 (= K172), P187 (= P198), G188 (= G199), G189 (≠ P200), T190 (≠ V201), T192 (= T203), M194 (= M205)
4fj0D Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and 3,7-dihydroxy flavone (see paper)
35% identity, 94% coverage: 14:256/259 of query aligns to 7:259/261 of 4fj0D
- active site: G20 (= G27), S144 (= S154), N145 (≠ T155), H155 (≠ F165), Y158 (= Y168), K162 (= K172), Y203 (vs. gap)
- binding 3,7-dihydroxy-2-phenyl-4H-chromen-4-one: S144 (= S154), N145 (≠ T155), G190 (≠ P200), F196 (≠ N206), S200 (vs. gap), Y203 (vs. gap), A219 (= A221)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G23), R19 (= R26), G20 (= G27), I21 (= I28), A41 (≠ S48), N42 (≠ S49), S43 (= S50), I68 (≠ S75), N94 (= N101), S95 (≠ A102), G96 (= G103), L117 (≠ V124), T142 (≠ I152), Y158 (= Y168), K162 (= K172), P188 (= P198), G189 (= G199), G190 (≠ P200), T191 (≠ V201), T193 (= T203), M195 (= M205)
7nm8AAA Antimycin pathway standalone ketoreductase, AntM (see paper)
40% identity, 95% coverage: 11:256/259 of query aligns to 4:247/251 of 7nm8AAA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G23), S15 (≠ A25), R16 (= R26), G17 (= G27), I18 (= I28), H36 (≠ T46), Y37 (= Y47), G38 (≠ S48), H39 (≠ S49), L65 (vs. gap), N97 (= N101), G99 (= G103), S147 (≠ T155), Y160 (= Y168), K164 (= K172), G191 (= G199), T193 (≠ V201), T195 (= T203)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
37% identity, 94% coverage: 14:257/259 of query aligns to 3:245/247 of 4jroC
- active site: G16 (= G27), S142 (= S154), Q152 (≠ F165), Y155 (= Y168), K159 (= K172)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G23), S14 (≠ A25), R15 (= R26), G16 (= G27), I17 (= I28), N35 (≠ T46), Y36 (= Y47), N37 (≠ S48), G38 (≠ S49), S39 (= S50), N63 (≠ D74), V64 (≠ S75), N90 (= N101), A91 (= A102), I93 (≠ V104), I113 (≠ V124), S142 (= S154), Y155 (= Y168), K159 (= K172), P185 (= P198), I188 (≠ V201), T190 (= T203)
8hfkA Crystal structure of cbar mutant (h162f) in complex with NADP+ and halogenated aryl ketone (see paper)
36% identity, 94% coverage: 14:256/259 of query aligns to 6:257/259 of 8hfkA
- binding 2-bromanyl-1-(4-bromanyl-2-oxidanyl-phenyl)ethanone: S143 (≠ T155), N144 (= N156), T145 (≠ S157), F153 (= F165), Y156 (= Y168), G187 (= G199), M193 (= M205), V197 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G23), R18 (= R26), I20 (= I28), A40 (≠ S48), N41 (≠ S49), S42 (= S50), D66 (= D74), N93 (= N101), S94 (≠ A102), L116 (≠ V124), T141 (≠ G153), Y156 (= Y168), K160 (= K172), P186 (= P198), G187 (= G199), G188 (≠ P200), T189 (≠ V201), T191 (= T203), M193 (= M205)
Sites not aligning to the query:
Query Sequence
>Ac3H11_1292 FitnessBrowser__acidovorax_3H11:Ac3H11_1292
MSSVLASPPTHQPLAGKVALVTGGARGIGAAIVRRLARDGAAVAFTYSSSAAPAQALVAA
IESAGGKALALRADSADAAALTQAVDHAARTLGRLDILVNNAGVAVAGVLDSFSLADFDH
TLNVNVRAVFVATQAAVRHMGQGGAYGRVITIGSTNSDRVPWPGFSVYGMSKAAIVGLTK
GLARDLGPRGITVNNVQPGPVNTDMNPADGPMAGDMHGLMALNRHAHPDEIAGMVAYLAG
PESGMVTGASLLIDGGFAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory