Comparing Ac3H11_1332 Acetylornithine aminotransferase (EC 2.6.1.11) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
45% identity, 96% coverage: 11:392/398 of query aligns to 2:375/375 of 2eh6A
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
45% identity, 96% coverage: 11:392/398 of query aligns to 3:376/376 of O66442
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
45% identity, 97% coverage: 11:395/398 of query aligns to 10:393/393 of 2ordA
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
45% identity, 97% coverage: 11:395/398 of query aligns to 2:385/385 of Q9X2A5
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 98% coverage: 5:395/398 of query aligns to 62:456/457 of Q9M8M7
Sites not aligning to the query:
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
38% identity, 97% coverage: 10:395/398 of query aligns to 2:388/388 of 3nx3A
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
42% identity, 94% coverage: 12:387/398 of query aligns to 10:385/390 of 8ht4B
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
44% identity, 95% coverage: 12:388/398 of query aligns to 11:379/390 of A0QYS9
7nncC Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal-5'-phosphate and 6-methoxyquinoline-3-carboxylic acid
45% identity, 95% coverage: 12:388/398 of query aligns to 13:383/391 of 7nncC
7nn4A Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal 5'-phosphate and 3-hydroxy-2-naphthoic acid.
45% identity, 95% coverage: 12:388/398 of query aligns to 13:383/391 of 7nn4A
P9WPZ7 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
45% identity, 95% coverage: 12:388/398 of query aligns to 19:389/400 of P9WPZ7
Sites not aligning to the query:
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
40% identity, 99% coverage: 3:397/398 of query aligns to 11:395/395 of Q5SHH5
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
39% identity, 99% coverage: 3:397/398 of query aligns to 3:387/387 of 1wkhA
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
39% identity, 99% coverage: 3:397/398 of query aligns to 3:387/387 of 1wkgA
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
39% identity, 99% coverage: 3:397/398 of query aligns to 3:387/387 of 1vefA
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
41% identity, 89% coverage: 25:380/398 of query aligns to 25:383/402 of 4jevB
4addA Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
40% identity, 92% coverage: 16:380/398 of query aligns to 16:383/400 of 4addA
4adbB Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
40% identity, 92% coverage: 16:380/398 of query aligns to 16:383/401 of 4adbB
P40732 Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
41% identity, 89% coverage: 25:380/398 of query aligns to 30:388/405 of P40732
5e3kB Crystal structure of the ornithine aminotransferase from toxoplasma gondii me49 in a complex with (s)-4-amino-5-fluoropentanoic acid
35% identity, 99% coverage: 4:397/398 of query aligns to 21:418/424 of 5e3kB
>Ac3H11_1332 Acetylornithine aminotransferase (EC 2.6.1.11)
MTAFIEAASPHVMNTYGRVPIALERGQGCRVWDVNGKEYIDGLGGIAVNTLGHNHGKLVP
ALQDQIAKLIHTSNYYHVPLQEKLATKLVELSGMQNVFFCNSGLEANEAALKIARKFGVD
KGIAKPEIVVYEKAFHGRSIATMSATGNPKIHNGFGPLVEGFVRVPMNDIEAIKQATEGN
PNVVAVFFETIQGEGGINGMRIEYLQQLRKLCDERGWLMMIDEVQCGMGRTGKWFAHQWA
GIVPDVMPLAKGLGSGVPIGAVVAGPKAANVLQPGNHGTTFGGNPLAMRAGVETIRIMEE
DGLLHNAAQVGDHLRAALQRELGSLPGVKEIRGQGLMLGIELNKPCGALIGRAAEAGLLL
SVTADSVIRLVPPLILTTAEADAIVAILTPLVKAILAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory