SitesBLAST
Comparing Ac3H11_1333 Ornithine carbamoyltransferase (EC 2.1.3.3) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q51742 Ornithine carbamoyltransferase, anabolic; OTCase; EC 2.1.3.3 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 3 papers)
45% identity, 97% coverage: 8:325/328 of query aligns to 2:312/315 of Q51742
- W22 (≠ A28) mutation to A: Decreased heat stability.
- E26 (= E32) mutation to Q: Increased dissociation of dodecamers into trimers.
- M30 (≠ L36) mutation to A: Increased dissociation of dodecamers into trimers.
- W34 (≠ K40) mutation to A: Increased dissociation of dodecamers into trimers.
- Y228 (≠ T241) mutation to C: Becomes active at low temperatures; when associated with G-278.
- A241 (≠ N254) mutation to D: Becomes active at low temperatures; when associated with G-278.
- E278 (= E291) mutation to G: Becomes active at low temperatures; when associated with C-228 or D-241.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
8qeuA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with ornithine (see paper)
42% identity, 95% coverage: 13:323/328 of query aligns to 1:302/304 of 8qeuA
Q81M99 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Bacillus anthracis
42% identity, 93% coverage: 14:319/328 of query aligns to 12:305/316 of Q81M99
4nf2A Crystal structure of anabolic ornithine carbamoyltransferase from bacillus anthracis in complex with carbamoyl phosphate and l- norvaline
42% identity, 93% coverage: 14:319/328 of query aligns to 8:301/307 of 4nf2A
- active site: R55 (= R65), T56 (= T66), R83 (= R93), R104 (= R114), H131 (= H141), Q134 (= Q144), D226 (= D243), C265 (= C283), R293 (= R311)
- binding phosphoric acid mono(formamide)ester: S53 (= S63), T54 (= T64), R55 (= R65), T56 (= T66), R104 (= R114), H131 (= H141), Q134 (= Q144), C265 (= C283), L266 (= L284), R293 (= R311)
- binding norvaline: L126 (= L136), N162 (= N182), D226 (= D243), S230 (= S247), M231 (= M248)
8qevA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with carbamoyl phosphate (see paper)
40% identity, 95% coverage: 13:323/328 of query aligns to 1:295/297 of 8qevA
7nouA Crystal structure of mycobacterium tuberculosis argf in complex with (3,5-dichlorophenyl)boronic acid.
42% identity, 95% coverage: 11:323/328 of query aligns to 1:305/308 of 7nouA
- active site: R102 (= R114), H129 (= H141), Q132 (= Q144), D225 (= D243), C265 (= C283), R293 (= R311)
- binding [3,5-bis(chloranyl)phenyl]-oxidanyl-oxidanylidene-boron: I46 (= I58), T52 (= T64), R53 (= R65), R53 (= R65), F56 (≠ V68), F56 (≠ V68), L79 (= L91), D82 (≠ A94), E83 (= E95), V91 (= V103), Y95 (≠ M107), L266 (= L284), R293 (= R311)
7nosA Crystal structure of mycobacterium tuberculosis argf in complex with 4-bromo-6-(trifluoromethyl)-1h-benzo[d]imidazole.
42% identity, 95% coverage: 11:323/328 of query aligns to 1:305/308 of 7nosA
7norA Crystal structure of mycobacterium tuberculosis argf in complex with 2-fluoro-4-hydroxybenzonitrile.
42% identity, 95% coverage: 11:323/328 of query aligns to 1:305/308 of 7norA
7nnyA Crystal structure of mycobacterium tuberculosis argf in complex with naphthalen-1-ol.
42% identity, 95% coverage: 11:323/328 of query aligns to 1:305/308 of 7nnyA
- active site: R102 (= R114), H129 (= H141), Q132 (= Q144), D225 (= D243), C265 (= C283), R293 (= R311)
- binding 1-naphthol: T52 (= T64), R53 (= R65), F56 (≠ V68), E83 (= E95), V91 (= V103), Y95 (≠ M107)
7nnwA Crystal structure of mycobacterium tuberculosis argf in complex with methyl 4-hydroxy-3-iodobenzoate.
42% identity, 95% coverage: 11:323/328 of query aligns to 1:305/308 of 7nnwA
- active site: R102 (= R114), H129 (= H141), Q132 (= Q144), D225 (= D243), C265 (= C283), R293 (= R311)
- binding methyl 3-iodanyl-4-oxidanyl-benzoate: I46 (= I58), T52 (= T64), R53 (= R65), F56 (≠ V68), L79 (= L91), L92 (≠ I104), Y95 (≠ M107)
7nnvA Crystal structure of mycobacterium tuberculosis argf in complex with carbamoyl phosphate.
42% identity, 95% coverage: 11:323/328 of query aligns to 1:305/308 of 7nnvA
- active site: R102 (= R114), H129 (= H141), Q132 (= Q144), D225 (= D243), C265 (= C283), R293 (= R311)
- binding phosphoric acid mono(formamide)ester: S51 (= S63), T52 (= T64), R53 (= R65), T54 (= T66), R102 (= R114), H129 (= H141), C265 (= C283), L266 (= L284), R293 (= R311)
2i6uA Crystal structure of ornithine carbamoyltransferase complexed with carbamoyl phosphate and l-norvaline from mycobacterium tuberculosis (rv1656) at 2.2 a (see paper)
42% identity, 95% coverage: 13:323/328 of query aligns to 2:304/307 of 2i6uA
- active site: R52 (= R65), T53 (= T66), R80 (= R93), R101 (= R114), H128 (= H141), Q131 (= Q144), D224 (= D243), C264 (= C283), R292 (= R311)
- binding phosphoric acid mono(formamide)ester: S50 (= S63), T51 (= T64), R52 (= R65), T53 (= T66), R101 (= R114), C264 (= C283), L265 (= L284), R292 (= R311)
- binding norvaline: L123 (= L136), N160 (= N182), D224 (= D243), S228 (= S247), M229 (= M248)
P9WIT9 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
42% identity, 95% coverage: 13:323/328 of query aligns to 2:304/307 of P9WIT9
7np0A Crystal structure of mycobacterium tuberculosis argf in complex with (4-nitrophenyl)boronic acid.
42% identity, 95% coverage: 11:323/328 of query aligns to 1:302/305 of 7np0A
7nnzB Crystal structure of mycobacterium tuberculosis argf in complex with 5-methyl-4-phenylthiazol-2-amine.
41% identity, 95% coverage: 13:323/328 of query aligns to 2:294/297 of 7nnzB
7novA Crystal structure of mycobacterium tuberculosis argf in complex with (4-methyl-3-nitrophenyl)boronic acid.
41% identity, 95% coverage: 11:323/328 of query aligns to 1:299/302 of 7novA
- active site: R96 (= R114), H123 (= H141), Q126 (= Q144), D219 (= D243), C259 (= C283), R287 (= R311)
- binding (4-methyl-3-nitro-phenyl)-oxidanyl-oxidanylidene-boron: R53 (= R65), F56 (≠ V68), E77 (= E95), V85 (= V103), Y89 (≠ M107), L260 (= L284), A284 (= A308), R287 (= R311)
P00481 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Rattus norvegicus (Rat) (see 2 papers)
39% identity, 94% coverage: 17:323/328 of query aligns to 43:342/354 of P00481
- R92 (= R65) mutation to L: Strong decrease in ornithine carbamoyltransferase activity.
- C303 (= C283) mutation to S: Increases KM for ornithine 5-fold and decreases kcat 20-fold.
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
P00480 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Homo sapiens (Human) (see 31 papers)
38% identity, 94% coverage: 17:323/328 of query aligns to 43:342/354 of P00480
- L43 (= L17) to F: in dbSNP:rs72554309
- K46 (≠ T20) to R: in dbSNP:rs1800321
- Y55 (= Y29) to D: in OTCD; late onset; dbSNP:rs72554319
- L63 (≠ I37) to P: in OTCD; late onset; dbSNP:rs72554324
- K88 (= K61) modified: N6-acetyllysine; alternate; to N: in OTCD; late onset; dbSNP:rs72554339
- STRT 90:93 (= STRT 63:66) binding
- G100 (= G73) to D: in OTCD; late onset; dbSNP:rs72554349
- F101 (≠ M74) to L: in dbSNP:rs1133135
- L111 (= L84) to P: in dbSNP:rs1800324
- T125 (≠ E98) to M: in OTCD; neonatal; dbSNP:rs72554356
- D126 (= D99) to G: in OTCD; early onset; loss of ornithine carbamoyltransferase activity; 0.9% of wild-type activity; dbSNP:rs72554358
- R129 (≠ K102) to H: in OTCD; early onset; decreased ornithine carbamoyltransferase activity; 2.1% of wild-type activity; dbSNP:rs66656800
- A140 (≠ I113) to P: in OTCD; late onset; dbSNP:rs72556260
- R141 (= R114) binding ; to Q: in OTCD; most common variant; loss of ornithine carbamoyltransferase activity; activity is 100-fold lower; dbSNP:rs68026851
- H168 (= H141) binding
- Q171 (= Q144) binding
- I172 (= I145) to M: in OTCD; early onset; loss of ornithine carbamoyltransferase activity; dbSNP:rs72556280
- Y176 (≠ I149) to C: in OTCD; late onset; dbSNP:rs72556283
- TL 178:179 (≠ TF 151:152) natural variant: Missing (in OTCD; neonatal)
- Y183 (≠ R156) to D: in OTCD; late onset; dbSNP:rs72556292
- G188 (= G171) to R: in OTCD; neonatal; dbSNP:rs72556294
- G195 (= G178) to R: in OTCD; loss of ornithine carbamoyltransferase activity; dbSNP:rs67294955
- D196 (= D179) to V: in OTCD; neonatal; decreased ornithine carbamoyltransferase activity; 3.7% activity; dbSNP:rs72556300
- L201 (≠ A184) to P: in OTCD; neonatal; dbSNP:rs72558407
- S207 (≠ A190) to R: in OTCD; neonatal; dbSNP:rs72558415
- A209 (≠ S192) to V: in OTCD; neonatal; dbSNP:rs72558417
- M213 (≠ F196) to K: in OTCD; late onset
- H214 (≠ K197) to Y: in OTCD; neonatal; dbSNP:rs72558420
- P220 (= P203) to A: in OTCD; late onset; dbSNP:rs72558425
- P225 (≠ I208) to T: in OTCD; late onset; dbSNP:rs72558428
- L244 (≠ Y224) to Q: in OTCD; late onset; dbSNP:rs72558436
- T262 (= T242) to K: in OTCD; mild; dbSNP:rs67333670
- T264 (≠ V244) to A: in OTCD; late onset; decreased ornithine carbamoyltransferase activity; 8.9% activity; dbSNP:rs72558444; to I: in OTCD; late onset; dbSNP:rs67156896
- W265 (= W245) to L: in OTCD; mild; dbSNP:rs72558446
- G269 (= G249) to E: in OTCD; neonatal; dbSNP:rs72558450
- Q270 (≠ Y250) to R: in dbSNP:rs1800328
- E272 (≠ A252) natural variant: Missing (in OTCD; late onset; dbSNP:rs72558452)
- R277 (= R257) to Q: in OTCD; late onset; dbSNP:rs66724222; to W: in OTCD; late onset; dbSNP:rs72558454
- H302 (= H282) to L: in OTCD; female; late onset; dbSNP:rs67993095; to Y: in OTCD; neonatal; dbSNP:rs72558463
- C303 (= C283) to R: in OTCD; neonatal; dbSNP:rs67468335
- CL 303:304 (= CL 283:284) binding
- E309 (= E290) natural variant: Missing (in OTCD; late onset)
- R330 (= R311) binding
- T333 (≠ V314) natural variant: T -> A
- S340 (≠ Y321) to P: in OTCD; late onset; dbSNP:rs72558489
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
- 15 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-23 and G-26.
- 23 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-26.
- 26 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-23.
- 39 G → C: in OTCD; late onset; dbSNP:rs72554306
- 40 R → H: in OTCD; late onset; dbSNP:rs72554308
- 343 T → K: in OTCD; late onset; dbSNP:rs72558491
1othA Crystal structure of human ornithine transcarbamoylase complexed with n-phosphonacetyl-l-ornithine (see paper)
38% identity, 94% coverage: 17:323/328 of query aligns to 10:309/321 of 1othA
- active site: R59 (= R65), T60 (= T66), V87 (≠ R93), R108 (= R114), H135 (= H141), Q138 (= Q144), D230 (= D243), C270 (= C283), R297 (= R311)
- binding n-(phosphonoacetyl)-l-ornithine: S57 (= S63), T58 (= T64), R59 (= R65), T60 (= T66), R108 (= R114), L130 (= L136), H135 (= H141), N166 (= N182), D230 (= D243), S234 (= S247), M235 (= M248), C270 (= C283), L271 (= L284), R297 (= R311)
1c9yA Human ornithine transcarbamylase: crystallographic insights into substrate recognition and catalytic mechanism (see paper)
38% identity, 94% coverage: 17:323/328 of query aligns to 10:309/321 of 1c9yA
- active site: R59 (= R65), T60 (= T66), V87 (≠ R93), R108 (= R114), H135 (= H141), Q138 (= Q144), D230 (= D243), C270 (= C283), R297 (= R311)
- binding phosphoric acid mono(formamide)ester: S57 (= S63), T58 (= T64), R59 (= R65), T60 (= T66), R108 (= R114), C270 (= C283), L271 (= L284), R297 (= R311)
- binding norvaline: L130 (= L136), N166 (= N182), D230 (= D243), S234 (= S247), M235 (= M248)
Query Sequence
>Ac3H11_1333 Ornithine carbamoyltransferase (EC 2.1.3.3)
MKLKQSKIVMTTLKHYLQFTDLNADEYAYLFERAALIKKKFKAYDKHHPLVDRTLAMIFE
KASTRTRVSFEAGMYQLGGSVVHLTTGDSQLGRAEPIEDSAKVISRMTDLVMIRTYEQAK
IERFAANSRVPVINGLTNEYHPCQILADIFTFIEHRGPKDGTGNLTDCLKGKTVAWVGDG
NNMANTWVQAASLLGFKVHVSTPRGYEIDEKLAAGAHGISADSYQFFSNPMEACRGADLV
TTDVWTSMGYEAENEARKKAFADWCVDTEMMAAAQPDALFMHCLPAHRGEEVEADVIDGP
QSVVWDEAENRMHVQKALMEYLLLGRVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory