SitesBLAST
Comparing Ac3H11_1358 Valine--pyruvate aminotransferase (EC 2.6.1.66) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
45% identity, 97% coverage: 11:398/401 of query aligns to 1:388/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: I18 (= I26), R19 (= R27), G35 (= G43), G36 (= G44), G95 (= G105), S96 (= S106), Q97 (= Q107), Y121 (= Y131), N170 (= N182), D198 (= D210), Y201 (= Y213), S231 (= S239), S233 (= S241), K234 (= K242), R241 (= R249), R364 (= R374)
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
45% identity, 97% coverage: 11:398/401 of query aligns to 1:388/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G105), S96 (= S106), Q97 (= Q107), Y121 (= Y131), N170 (= N182), D198 (= D210), A200 (≠ P212), Y201 (= Y213), S231 (= S239), S233 (= S241), K234 (= K242), R241 (= R249)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
45% identity, 97% coverage: 11:398/401 of query aligns to 5:392/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: I22 (= I26), R23 (= R27), G39 (= G43), G40 (= G44), G99 (= G105), S100 (= S106), Q101 (= Q107), Y125 (= Y131), N174 (= N182), D202 (= D210), Y205 (= Y213), S235 (= S239), S237 (= S241), K238 (= K242), R245 (= R249), R368 (= R374)
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
45% identity, 97% coverage: 11:398/401 of query aligns to 5:392/397 of Q72LL6
- S20 (= S24) mutation to E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- R23 (= R27) mutation to A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; mutation to Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
- G40 (= G44) binding
- Y70 (= Y74) binding
- N174 (= N182) binding ; binding
- R245 (= R249) binding
- R368 (= R374) binding
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
41% identity, 96% coverage: 14:399/401 of query aligns to 10:401/404 of 3wx9A
- binding 4-(2-aminophenyl)-2,4-dioxobutanoic acid: R23 (= R27), G40 (= G44), L41 (= L45)
- binding 2-oxoglutaric acid: D213 (≠ N211), P214 (= P212), Y215 (= Y213), G216 (= G214), E217 (≠ D215), G241 (= G238), T242 (≠ S239), I246 (≠ V243)
- binding (2E)-pent-2-enedioic acid: G40 (= G44), Y130 (= Y131), N184 (= N182), R376 (= R374)
- binding glutamic acid: S20 (= S24), V22 (≠ I26), L131 (= L132), V360 (= V358), A364 (= A362), R369 (≠ N367)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G105), S105 (= S106), Q106 (= Q107), Y130 (= Y131), N184 (= N182), D212 (= D210), P214 (= P212), Y215 (= Y213), T242 (≠ S239), S244 (= S241), K245 (= K242), R252 (= R249)
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
41% identity, 96% coverage: 14:399/401 of query aligns to 10:401/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: S20 (= S24), V22 (≠ I26), R23 (= R27), L131 (= L132), Q135 (= Q136), A364 (= A362), R369 (≠ N367)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: R23 (= R27), G40 (= G44), Y130 (= Y131), L131 (= L132), A132 (≠ G133), N184 (= N182), R376 (= R374)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G105), S105 (= S106), Q106 (= Q107), Y130 (= Y131), V179 (≠ L177), N184 (= N182), D212 (= D210), P214 (= P212), Y215 (= Y213), T242 (≠ S239), S244 (= S241), K245 (= K242), R252 (= R249)
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
41% identity, 96% coverage: 14:399/401 of query aligns to 10:401/404 of 3aowC
- binding 2-oxoglutaric acid: R23 (= R27), Y70 (= Y74), Y130 (= Y131), L275 (= L272)
- binding pyridoxal-5'-phosphate: G104 (= G105), S105 (= S106), Q106 (= Q107), Y130 (= Y131), V179 (≠ L177), N184 (= N182), D212 (= D210), P214 (= P212), Y215 (= Y213), T242 (≠ S239), S244 (= S241), K245 (= K242), R252 (= R249)
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
41% identity, 96% coverage: 14:399/401 of query aligns to 10:401/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G105), S105 (= S106), Q106 (= Q107), Y130 (= Y131), V179 (≠ L177), N184 (= N182), D212 (= D210), P214 (= P212), Y215 (= Y213), T242 (≠ S239), S244 (= S241), K245 (= K242), R252 (= R249)
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
45% identity, 97% coverage: 11:398/401 of query aligns to 2:384/389 of 2z1yA
- binding leucine: G32 (= G44), Y117 (= Y131), R360 (= R374)
- binding pyridoxal-5'-phosphate: G91 (= G105), S92 (= S106), Q93 (= Q107), Y117 (= Y131), N166 (= N182), D194 (= D210), Y197 (= Y213), S227 (= S239), S229 (= S241), K230 (= K242), R237 (= R249)
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
39% identity, 96% coverage: 14:399/401 of query aligns to 7:399/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G105), S103 (= S106), Q104 (= Q107), Y128 (= Y131), V177 (≠ L177), N182 (= N182), D210 (= D210), P212 (= P212), Y213 (= Y213), T240 (≠ S239), S242 (= S241), K243 (= K242), R250 (= R249)
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
35% identity, 98% coverage: 9:399/401 of query aligns to 11:413/420 of 1vp4A
- binding pyridoxal-5'-phosphate: G112 (= G105), S113 (= S106), Q114 (= Q107), Y138 (= Y131), N194 (= N182), D222 (= D210), P224 (= P212), Y225 (= Y213), T252 (≠ S239), S254 (= S241), K255 (= K242), R262 (= R249)
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
33% identity, 96% coverage: 9:393/401 of query aligns to 2:398/405 of 2zc0A
- active site: Y132 (= Y131), D214 (= D210), A216 (≠ P212), S246 (= S241)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G106 (= G105), G107 (≠ S106), T108 (≠ Q107), Y132 (= Y131), N186 (= N182), D214 (= D210), A216 (≠ P212), Y217 (= Y213), T244 (≠ S239), S246 (= S241), K247 (= K242), R254 (= R249)
4gebA Kynurenine aminotransferase ii inhibitors (see paper)
30% identity, 94% coverage: 22:397/401 of query aligns to 15:422/428 of 4gebA
- binding (5-hydroxy-4-{[(7-hydroxy-6-oxo-2-phenyl-6,7-dihydro-2H-pyrazolo[3,4-b]pyridin-5-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G39 (= G44), L40 (= L45), Y74 (= Y74), S117 (= S106), Q118 (= Q107), Y142 (= Y131), N202 (= N182), D230 (= D210), P232 (= P212), Y233 (= Y213), S260 (= S239), S262 (= S241), K263 (= K242), R270 (= R249), R399 (= R374)
4ge9A Kynurenine aminotransferase ii inhibitors (see paper)
30% identity, 94% coverage: 22:397/401 of query aligns to 15:422/428 of 4ge9A
- binding (4-{[(6-benzyl-1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: I19 (= I26), R20 (= R27), T23 (≠ L30), G39 (= G44), L40 (= L45), Y74 (= Y74), S75 (≠ A75), S77 (= S77), S117 (= S106), Q118 (= Q107), Y142 (= Y131), N202 (= N182), D230 (= D210), P232 (= P212), Y233 (= Y213), S260 (= S239), S262 (= S241), R270 (= R249), L293 (= L272), R399 (= R374)
4ge7A Kynurenine aminotransferase ii inhibitors (see paper)
30% identity, 94% coverage: 22:397/401 of query aligns to 15:422/428 of 4ge7A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-6-phenoxy-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: I19 (= I26), G39 (= G44), Y74 (= Y74), S75 (≠ A75), S77 (= S77), S117 (= S106), Q118 (= Q107), Y142 (= Y131), N202 (= N182), D230 (= D210), P232 (= P212), Y233 (= Y213), S260 (= S239), S262 (= S241), R270 (= R249), L293 (= L272), R399 (= R374)
4gdyB Kynurenine aminotransferase ii inhibitors
30% identity, 94% coverage: 22:397/401 of query aligns to 15:422/428 of 4gdyB
- binding (5-hydroxy-6-methyl-4-{[(1-oxo-7-phenoxy-1,2-dihydro[1,2,4]triazolo[4,3-a]quinolin-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: I19 (= I26), M33 (≠ I38), G39 (= G44), Y74 (= Y74), S75 (≠ A75), G116 (= G105), S117 (= S106), Q118 (= Q107), Y142 (= Y131), N202 (= N182), D230 (= D210), P232 (= P212), S260 (= S239), S262 (= S241), R270 (= R249), R399 (= R374)
6t8qA Hkatii in complex with ligand (2r)-n-benzyl-1-[6-methyl-5-(oxan-4-yl)- 7-oxo-6h,7h-[1,3]thiazolo[5,4-d]pyrimidin-2-yl]pyrrolidine-2- carboxamide (see paper)
30% identity, 94% coverage: 22:397/401 of query aligns to 18:425/428 of 6t8qA
5tf5A Crystal structure of human kat-2 in complex with a reversible inhibitor
30% identity, 94% coverage: 22:397/401 of query aligns to 15:422/425 of 5tf5A
2r2nA The crystal structure of human kynurenine aminotransferase ii in complex with kynurenine (see paper)
30% identity, 94% coverage: 22:397/401 of query aligns to 15:422/425 of 2r2nA
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: I19 (= I26), R20 (= R27), Y142 (= Y131), R399 (= R374)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S117 (= S106), Q118 (= Q107), Y142 (= Y131), N202 (= N182), D230 (= D210), P232 (= P212), Y233 (= Y213), S260 (= S239), S262 (= S241), K263 (= K242), R270 (= R249)
4ge4A Kynurenine aminotransferase ii inhibitors (see paper)
30% identity, 94% coverage: 22:397/401 of query aligns to 15:416/422 of 4ge4A
- binding (5-hydroxy-4-{[(1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: I19 (= I26), G34 (= G43), G35 (= G44), L36 (= L45), Y68 (= Y74), G110 (= G105), S111 (= S106), Q112 (= Q107), Y136 (= Y131), N196 (= N182), D224 (= D210), P226 (= P212), Y227 (= Y213), S254 (= S239), S256 (= S241), K257 (= K242), R264 (= R249), R393 (= R374)
Query Sequence
>Ac3H11_1358 Valine--pyruvate aminotransferase (EC 2.6.1.66)
VKLNDLPQNSTWTLARRAERMNPSVIREILKVTEKPGIISLAGGLPSPKTFPVSAFAAAS
AAVLANDGPAALQYAASEGYAPLRQAIADFLPWDVDADQILITTGSQQALDLIAKVLIDE
NSRVLVETPTYLGALQAFTPMEPSVVAVASDDEGVLIDDLKAKVGTGADKARFLYVLPNF
QNPTGRTMTEARRAALVKAAAELNLPLVEDNPYGDLWFDNPPPAPLTARNPEGCIYMGSF
SKVLAPGLRLGFVVAPKAVYPKLLQAKQAADLHTPGYNQRLVAEVMKGNFLDRHVPTIRA
LYKQQCEAMLAALTQEMAGLGVEWNRPDGGMFLWVRLPEGMSAIELLPQAVERNVAFVPG
AAFYADNADPRTLRLSFVTSTVEQIATGIAALAAAIRSHKG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory