Comparing Ac3H11_142 FitnessBrowser__acidovorax_3H11:Ac3H11_142 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
37% identity, 95% coverage: 6:302/313 of query aligns to 3:302/304 of 1wwkA
7dkmA Phgdh covalently linked to oridonin (see paper)
39% identity, 78% coverage: 49:291/313 of query aligns to 47:292/306 of 7dkmA
Sites not aligning to the query:
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
39% identity, 78% coverage: 49:291/313 of query aligns to 46:291/303 of 6plgA
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
39% identity, 78% coverage: 49:291/313 of query aligns to 46:291/302 of 7ewhA
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
39% identity, 78% coverage: 49:291/313 of query aligns to 46:291/302 of 6rihA
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
39% identity, 78% coverage: 49:291/313 of query aligns to 47:292/305 of 6plfA
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
39% identity, 78% coverage: 49:291/313 of query aligns to 43:288/299 of 6rj2A
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
39% identity, 78% coverage: 49:291/313 of query aligns to 45:290/297 of 6rj3A
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
39% identity, 78% coverage: 49:291/313 of query aligns to 45:290/299 of 6cwaA
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
39% identity, 78% coverage: 49:291/313 of query aligns to 51:296/533 of O43175
Sites not aligning to the query:
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
39% identity, 78% coverage: 49:291/313 of query aligns to 46:291/301 of 6rj5A
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
38% identity, 78% coverage: 49:291/313 of query aligns to 41:282/292 of 6plfB
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
39% identity, 87% coverage: 32:303/313 of query aligns to 31:303/525 of 3ddnB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
39% identity, 87% coverage: 32:303/313 of query aligns to 30:302/526 of 3dc2A
Sites not aligning to the query:
7cvpA The crystal structure of human phgdh from biortus.
35% identity, 74% coverage: 60:291/313 of query aligns to 3:245/254 of 7cvpA
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
32% identity, 92% coverage: 11:298/313 of query aligns to 63:364/466 of P87228
7va1A Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with gdd-04-35
39% identity, 60% coverage: 99:286/313 of query aligns to 1:190/193 of 7va1A
5ofwA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-chloro-4-fluorobenzamide (see paper)
39% identity, 60% coverage: 99:286/313 of query aligns to 3:192/195 of 5ofwA
5ofvA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-fluoro-2-methylbenzoic acid (see paper)
39% identity, 60% coverage: 99:286/313 of query aligns to 3:192/195 of 5ofvA
5ofmA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-amino-1-methyl-1h-indole
39% identity, 60% coverage: 99:286/313 of query aligns to 3:192/195 of 5ofmA
>Ac3H11_142 FitnessBrowser__acidovorax_3H11:Ac3H11_142
VSPTIIVTGADLAQHALELLAGYDIVYAGKAPTEDDLVALCGAHNPVAIIVRYGKVGAAV
MDAAPALKVISKHGSGTDTIDKVAAKARGIEVVAAVGANAAAVAEQALTLLLACAKSVVQ
LDARMHAGHWDKATHKSLELGGRTVGLVGLGAIGLRFAKMADALGMRVIGFDPFAKNLPD
YVQSVGLETIWREADAVSLHCPLTDENRGMLNATTLAQCKRGVIVVNTARGGLIDEAALL
AAVRSGQVMAAGLDSFAVEPMTTGHPFQGEKHFILSPHIGGVTSDAYVNMGVGAAQNLLA
VLARVPGAAVAAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory