SitesBLAST
Comparing Ac3H11_1447 FitnessBrowser__acidovorax_3H11:Ac3H11_1447 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7arcF Cryo-em structure of polytomella complex-i (peripheral arm) (see paper)
50% identity, 89% coverage: 40:442/452 of query aligns to 27:426/430 of 7arcF
- binding flavin mononucleotide: G61 (= G80), R62 (= R81), K72 (= K91), N90 (= N108), D92 (= D110), E93 (= E111), S94 (≠ G112), Y178 (= Y196), G181 (= G199), E182 (= E200), T217 (≠ N235), N218 (= N236), L401 (= L417)
- binding iron/sulfur cluster: S352 (= S368), C353 (= C369), G354 (= G370), Q355 (= Q371), C356 (= C372), C359 (= C375), T397 (= T413), C399 (= C415), L401 (= L417)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
49% identity, 90% coverage: 37:444/452 of query aligns to 26:429/438 of Q56222
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
49% identity, 90% coverage: 37:444/452 of query aligns to 25:428/437 of 4hea1
- binding flavin mononucleotide: G63 (= G80), K74 (= K91), N91 (= N108), D93 (= D110), Y179 (= Y196), G182 (= G199), E183 (= E200), N218 (= N235), N219 (= N236), L401 (= L417)
- binding iron/sulfur cluster: I180 (= I197), P198 (= P215), S351 (= S368), C352 (= C369), G353 (= G370), K354 (≠ Q371), C355 (= C372), C358 (= C375), F398 (≠ I414), C399 (= C415), L401 (= L417)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
49% identity, 90% coverage: 37:444/452 of query aligns to 25:428/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G80), G65 (= G82), N91 (= N108), D93 (= D110), G182 (= G199), E183 (= E200), E184 (= E201), N218 (= N235), N219 (= N236), T222 (= T239), P400 (≠ A416)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G82), G66 (= G83), F69 (= F86), K74 (= K91), F77 (= F94), E96 (= E113), Y179 (= Y196), E184 (= E201), K201 (= K218), F204 (= F221), T324 (≠ S341)
- binding iron/sulfur cluster: S351 (= S368), C352 (= C369), K354 (≠ Q371), C355 (= C372), C358 (= C375), F398 (≠ I414), C399 (= C415), L401 (= L417), A402 (≠ G418)
7aqrF Cryo-em structure of arabidopsis thaliana complex-i (peripheral arm) (see paper)
53% identity, 81% coverage: 67:432/452 of query aligns to 47:415/434 of 7aqrF
- binding flavin mononucleotide: G60 (= G80), R61 (= R81), G62 (= G82), K71 (= K91), N89 (= N108), D91 (= D110), Y177 (= Y196), G180 (= G199), E181 (= E200), E182 (= E201), T216 (≠ N235), N217 (= N236)
- binding iron/sulfur cluster: S351 (= S368), C352 (= C369), G353 (= G370), Q354 (= Q371), C355 (= C372), C358 (= C375), T396 (= T413), C398 (= C415), L400 (= L417)
7dgq8 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (see paper)
49% identity, 90% coverage: 37:442/452 of query aligns to 19:421/427 of 7dgq8
- binding flavin mononucleotide: G58 (= G82), K67 (= K91), N85 (= N108), D87 (= D110), E88 (= E111), G89 (= G112), C175 (= C198), G176 (= G199), A212 (≠ N235), N213 (= N236)
- binding iron/sulfur cluster: S347 (= S368), C348 (= C369), G349 (= G370), C351 (= C372), C354 (= C375), C394 (= C415), L396 (= L417)
- binding : R121 (≠ S144), Y132 (≠ F155), Q139 (≠ E162), R143 (≠ E166), Y146 (≠ R169), E147 (≠ A170), F165 (≠ H188), R168 (≠ H191)
7v2cA Active state complex i from q10 dataset (see paper)
47% identity, 94% coverage: 17:442/452 of query aligns to 4:427/433 of 7v2cA
- binding flavin mononucleotide: G62 (= G80), K73 (= K91), N91 (= N108), Y179 (= Y196), G182 (= G199), E183 (= E200), N219 (= N236), A401 (= A416), L402 (= L417)
- binding iron/sulfur cluster: P198 (= P215), C354 (= C369), G355 (= G370), Q356 (= Q371), C357 (= C372), C360 (= C375), T398 (= T413), C400 (= C415), L402 (= L417)
6zk91 Peripheral domain of open complex i during turnover (see paper)
47% identity, 94% coverage: 17:442/452 of query aligns to 1:424/430 of 6zk91
- binding flavin mononucleotide: G59 (= G80), G61 (= G82), K70 (= K91), N88 (= N108), D90 (= D110), E91 (= E111), G179 (= G199), E180 (= E200), A215 (≠ N235), N216 (= N236), A398 (= A416), L399 (= L417)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G61 (= G82), G62 (= G83), A63 (= A84), F65 (= F86), K70 (= K91), E93 (= E113), Y176 (= Y196), E181 (= E201), F201 (= F221), T323 (≠ S341)
- binding iron/sulfur cluster: I177 (= I197), P195 (= P215), C351 (= C369), G352 (= G370), Q353 (= Q371), C354 (= C372), C357 (= C375), T395 (= T413), C397 (= C415), L399 (= L417)
P25708 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH dehydrogenase flavoprotein 1; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Bos taurus (Bovine) (see paper)
48% identity, 93% coverage: 17:437/452 of query aligns to 29:447/464 of P25708
- C379 (= C369) binding
- C382 (= C372) binding
- C385 (= C375) binding
- C425 (= C415) binding
5lnk1 Entire ovine respiratory complex i (see paper)
47% identity, 94% coverage: 17:442/452 of query aligns to 3:426/432 of 5lnk1
- binding fe2/s2 (inorganic) cluster: P96 (= P114), G97 (= G115)
- binding flavin mononucleotide: G61 (= G80), R62 (= R81), K72 (= K91), N90 (= N108), D92 (= D110), E93 (= E111), G94 (= G112), Y178 (= Y196), G181 (= G199), E182 (= E200), V216 (≠ I234), A217 (≠ N235), N218 (= N236), T221 (= T239), L401 (= L417)
- binding iron/sulfur cluster: P197 (= P215), S352 (= S368), C353 (= C369), Q355 (= Q371), C356 (= C372), C359 (= C375), T397 (= T413), I398 (= I414), C399 (= C415)
P49821 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH dehydrogenase flavoprotein 1; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Homo sapiens (Human) (see paper)
47% identity, 94% coverage: 17:442/452 of query aligns to 29:452/464 of P49821
- C379 (= C369) binding
- C382 (= C372) binding
- C385 (= C375) binding
- C425 (= C415) binding
Q91YT0 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Mus musculus (Mouse) (see 2 papers)
47% identity, 94% coverage: 17:442/452 of query aligns to 29:452/464 of Q91YT0
- C379 (= C369) binding
- C382 (= C372) binding
- C385 (= C375) binding
- C425 (= C415) binding
Sites not aligning to the query:
- 1:20 modified: transit peptide, Mitochondrion
8b9zF Drosophila melanogaster complex i in the active state (dm1) (see paper)
47% identity, 89% coverage: 37:437/452 of query aligns to 32:429/441 of 8b9zF
- binding flavin mononucleotide: G69 (= G80), G71 (= G82), K80 (= K91), N98 (= N108), D100 (= D110), G189 (= G199), E191 (= E201), N226 (= N236), A408 (= A416), L409 (= L417)
- binding iron/sulfur cluster: P205 (= P215), C361 (= C369), G362 (= G370), Q363 (= Q371), C364 (= C372), C367 (= C375), T405 (= T413), C407 (= C415), L409 (= L417)
8gymv1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial (see paper)
48% identity, 91% coverage: 40:451/452 of query aligns to 24:435/442 of 8gymv1
- binding flavin mononucleotide: G58 (= G80), G60 (= G82), N88 (= N108), D90 (= D110), Y176 (= Y196), E180 (= E200), E181 (= E201), T215 (≠ N235), N216 (= N236), T219 (= T239), A398 (= A416), L399 (= L417)
- binding iron/sulfur cluster: I177 (= I197), P195 (= P215), C351 (= C369), G352 (= G370), Q353 (= Q371), C354 (= C372), C357 (= C375), T395 (= T413), C397 (= C415), L399 (= L417), G400 (= G418)
8eswV1 NADH dehydrogenase (Ubiquinone) 24 kDa subunit, isoform A (see paper)
47% identity, 89% coverage: 37:437/452 of query aligns to 30:427/439 of 8eswV1
- binding flavin mononucleotide: G67 (= G80), G69 (= G82), K78 (= K91), N96 (= N108), D98 (= D110), E99 (= E111), G187 (= G199), E188 (= E200), N224 (= N236), A406 (= A416)
- binding iron/sulfur cluster: I185 (= I197), P203 (= P215), C359 (= C369), Q361 (= Q371), C362 (= C372), C365 (= C375), T403 (= T413), I404 (= I414), C405 (= C415), L407 (= L417)
- binding : Y143 (≠ F155), N144 (≠ Q156), Q150 (≠ E162), D174 (≠ Q186)
7o6yB Cryo-em structure of respiratory complex i under turnover (see paper)
44% identity, 90% coverage: 34:442/452 of query aligns to 17:425/457 of 7o6yB
- binding flavin mononucleotide: G57 (= G80), G59 (= G82), K68 (= K91), N89 (= N108), D91 (= D110), E92 (= E111), G180 (= G199), E181 (= E200), E182 (= E201), T216 (≠ N235), N217 (= N236)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G59 (= G82), G60 (= G83), F63 (= F86), K68 (= K91), E94 (= E113), Y177 (= Y196), E182 (= E201), F202 (= F221), T324 (≠ S341)
- binding iron/sulfur cluster: P196 (= P215), S351 (= S368), C352 (= C369), G353 (= G370), Q354 (= Q371), C355 (= C372), C358 (= C375), T396 (= T413), C398 (= C415), L400 (= L417)
7zm7B Cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) (see paper)
49% identity, 83% coverage: 66:442/452 of query aligns to 45:427/456 of 7zm7B
- binding flavin mononucleotide: G59 (= G80), G61 (= G82), K70 (= K91), N91 (= N108), D93 (= D110), G182 (= G199), E183 (= E200), E184 (= E201), A218 (≠ N235), N219 (= N236), A401 (= A416), L402 (= L417)
- binding iron/sulfur cluster: P198 (= P215), C354 (= C369), G355 (= G370), Q356 (= Q371), C357 (= C372), C360 (= C375), T398 (= T413), C400 (= C415), L402 (= L417)
7b0nF 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
44% identity, 90% coverage: 34:442/452 of query aligns to 18:426/460 of 7b0nF
- binding flavin mononucleotide: G60 (= G82), K69 (= K91), N90 (= N108), D92 (= D110), E93 (= E111), G94 (= G112), Y178 (= Y196), G181 (= G199), E182 (= E200), N218 (= N236)
- binding iron/sulfur cluster: P197 (= P215), S352 (= S368), C353 (= C369), Q355 (= Q371), C356 (= C372), C359 (= C375), T397 (= T413), C399 (= C415)
8e9hF Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
49% identity, 89% coverage: 38:438/452 of query aligns to 17:419/436 of 8e9hF
- binding flavin mononucleotide: G53 (= G80), R54 (= R81), G55 (= G82), A57 (= A84), K64 (= K91), N90 (= N108), D92 (= D110), Y178 (= Y196), G181 (= G199), E182 (= E200), E183 (= E201), N217 (= N235), N218 (= N236), S221 (≠ T239), L398 (= L417)
- binding iron/sulfur cluster: P197 (= P215), S349 (= S368), C350 (= C369), G351 (= G370), K352 (≠ Q371), C353 (= C372), C356 (= C375), S394 (≠ T413), F395 (≠ I414), C396 (= C415), L398 (= L417), G399 (= G418)
- binding zinc ion: C333 (≠ S352), E371 (≠ Q390)
Sites not aligning to the query:
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
45% identity, 92% coverage: 39:452/452 of query aligns to 164:571/630 of 8a6tB
- binding flavin mononucleotide: G201 (= G82), N227 (= N108), E230 (= E111), N355 (= N236), G535 (≠ A416), L536 (= L417)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E201), R337 (≠ K218), R340 (≠ F221), T341 (≠ P222), N342 (≠ A223), S433 (= S313)
- binding iron/sulfur cluster: S487 (= S368), C488 (= C369), G489 (= G370), C491 (= C372), C494 (= C375), C534 (= C415), L536 (= L417), G537 (= G418)
- binding zinc ion: C471 (≠ S352), H558 (≠ L439), C564 (≠ T445)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36, 82, 85, 86
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
Query Sequence
>Ac3H11_1447 FitnessBrowser__acidovorax_3H11:Ac3H11_1447
MTTAAQILSQFQATGVQTCFHDRHINPQIVAGLDGTNWSIKDYEARGGYAALRKILGTDG
GEPLTQDQVIATVKESGLRGRGGAGFPTGLKWSFMPRSFPGQKYLVCNSDEGEPGTCKDR
DILQFNPHIVIEGMIIAAYAMGISVGYNYIHGEIFQTYDRFEAALEEARAAGYLGDKILG
SNFSFQLHAAHGFGAYICGEETALLESLEGKKGQPRFKPPFPASFGLYGKPTTINNTETF
AAVPWIIRNGGAAYLECGKPNNGGTKIFSVSGDVEKPGNYEVPLGTPFAKLLELAGGVRK
GRQLKAVIPGGSSAPVLPASIIMECTMDYDSIAKAGSMLGSGAVIVMDDSRSMVESLLRL
SYFYSHESCGQCTPCREGTGWMWRVIDRIQHGQGRDGDLNLLNSVADNIQGRTICALGDA
AAMPVRAMIKHFRPEFEALIRQEKTPQASTSA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory