Comparing Ac3H11_1454 FitnessBrowser__acidovorax_3H11:Ac3H11_1454 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6neeB Crystal structure of a reconstructed ancestor of triosephosphate isomerase from eukaryotes (see paper)
50% identity, 99% coverage: 1:247/249 of query aligns to 1:250/252 of 6neeB
4y96A Crystal structure of triosephosphate isomerase from gemmata obscuriglobus (see paper)
49% identity, 99% coverage: 3:248/249 of query aligns to 1:249/250 of 4y96A
4mvaA 1.43 angstrom resolution crystal structure of triosephosphate isomerase (tpia) from escherichia coli in complex with acetyl phosphate. (see paper)
49% identity, 99% coverage: 4:249/249 of query aligns to 2:250/255 of 4mvaA
B1XB85 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Escherichia coli (strain K12 / DH10B) (see paper)
49% identity, 99% coverage: 4:249/249 of query aligns to 2:250/255 of B1XB85
6ooiC Crystal structure of triosephosphate isomerase from schistosoma mansoni in complex with 2pg (see paper)
45% identity, 98% coverage: 3:247/249 of query aligns to 7:253/255 of 6ooiC
5zfxB Crystal structure of triosephosphate isomerase from opisthorchis viverrini (see paper)
48% identity, 98% coverage: 4:247/249 of query aligns to 1:246/248 of 5zfxB
6oogA Crystal structure of triosephosphate isomerase from taenia solium in complex with 2pg (see paper)
45% identity, 99% coverage: 4:249/249 of query aligns to 5:252/252 of 6oogA
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
44% identity, 99% coverage: 3:249/249 of query aligns to 401:650/654 of P36204
Sites not aligning to the query:
A0A1L5YRA2 Triosephosphate isomerase; TIM; Allergen Scy p 8; Methylglyoxal synthase; Triose-phosphate isomerase; Allergen Scy p 8.0101; EC 5.3.1.1; EC 4.2.3.3 from Scylla paramamosain (Mud crab) (see paper)
47% identity, 99% coverage: 1:247/249 of query aligns to 1:246/248 of A0A1L5YRA2
5eywA Crystal structure of litopenaeus vannamei triosephosphate isomerase complexed with 2-phosphoglycolic acid (see paper)
46% identity, 98% coverage: 4:247/249 of query aligns to 1:243/244 of 5eywA
P50921 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Moritella marina (Vibrio marinus) (see paper)
48% identity, 94% coverage: 4:236/249 of query aligns to 2:239/256 of P50921
1aw1A Triosephosphate isomerase of vibrio marinus complexed with 2- phosphoglycolate (see paper)
48% identity, 94% coverage: 4:236/249 of query aligns to 1:238/255 of 1aw1A
1ci1B Crystal structure of triosephosphate isomerase from trypanosoma cruzi in hexane (see paper)
49% identity, 100% coverage: 2:249/249 of query aligns to 1:249/249 of 1ci1B
2y63A Crystal structure of leishmanial e65q-tim complexed with bromohydroxyacetone phosphate (see paper)
48% identity, 97% coverage: 9:249/249 of query aligns to 8:249/249 of 2y63A
2y61A Crystal structure of leishmanial e65q-tim complexed with s-glycidol phosphate (see paper)
48% identity, 97% coverage: 9:249/249 of query aligns to 8:249/249 of 2y61A
2vxnA E65q-tim complexed with phosphoglycolohydroxamate at 0.82 a resolution (see paper)
48% identity, 97% coverage: 9:249/249 of query aligns to 8:249/249 of 2vxnA
1if2A X-ray structure of leishmania mexicana triosephosphate isomerase complexed with ipp (see paper)
48% identity, 97% coverage: 9:249/249 of query aligns to 8:249/249 of 1if2A
1amkA Leishmania mexicana triose phosphate isomerase (see paper)
47% identity, 97% coverage: 9:249/249 of query aligns to 9:250/250 of 1amkA
1btmA Triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid (see paper)
46% identity, 99% coverage: 4:249/249 of query aligns to 1:250/251 of 1btmA
P00943 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
46% identity, 99% coverage: 4:249/249 of query aligns to 2:251/253 of P00943
>Ac3H11_1454 FitnessBrowser__acidovorax_3H11:Ac3H11_1454
MTNKKKLIAGNWKMNGSLAANEVLLKALIAGLGDVTCDVAVAVPAPYLAQVQALTAGTAV
AVAAQDVSRYESGAYTGEVSVAMLKDFGVRYALVGHSERRQYHGETDVAVAEKAQRALAA
GVTPIVCVGETLEEREAGQTEAVVKRQLAAVIHLNGHCISEIVVAYEPVWAIGTGRTASP
EQAQAVHAVLRAQLAAASEHADRIRLLYGGSMNAGNAAQLLAQPDIDGGLVGGASLKAAD
FLQIIAAAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory