SitesBLAST
Comparing Ac3H11_148 FitnessBrowser__acidovorax_3H11:Ac3H11_148 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
35% identity, 99% coverage: 1:258/260 of query aligns to 5:257/261 of 5u9pB
- active site: G27 (= G20), S152 (= S154), Y165 (= Y167), K169 (= K171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G16), R26 (≠ S19), G27 (= G20), I28 (≠ L21), R48 (= R41), D73 (= D66), V74 (= V67), N100 (= N93), A101 (≠ S94), I150 (= I152), Y165 (= Y167), K169 (= K171), P195 (= P197), F198 (≠ I200), T200 (= T202), L202 (≠ I204), N203 (= N205)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
37% identity, 98% coverage: 4:258/260 of query aligns to 5:244/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G16), D19 (≠ S18), L22 (= L21), I42 (≠ V36), D65 (= D59), M66 (≠ A60), N92 (= N93), A93 (≠ S94), G94 (= G95), L115 (≠ T116), I143 (= I152), S145 (= S154), Y158 (= Y167), K162 (= K171), G189 (= G198), M191 (≠ I200), T193 (= T202), N195 (≠ I204)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
35% identity, 96% coverage: 4:252/260 of query aligns to 3:239/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G16), R18 (≠ S19), G19 (= G20), I20 (≠ L21), D39 (≠ S40), R40 (= R41), C63 (≠ L65), I65 (≠ V67), N91 (= N93), G93 (= G95), I94 (≠ V96), V114 (≠ T116), Y155 (= Y167), K159 (= K171), I188 (= I200), T190 (= T202), T193 (≠ N205)
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
35% identity, 94% coverage: 5:249/260 of query aligns to 3:246/258 of 3ak4A
- active site: G18 (= G20), S141 (= S154), L151 (≠ I164), Y154 (= Y167), K158 (= K171), E199 (≠ D210)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ S19), G18 (= G20), I19 (≠ L21), D38 (≠ S40), L39 (≠ R41), V60 (≠ L65), D61 (= D66), V62 (= V67), N88 (= N93), A89 (≠ S94), G90 (= G95), T139 (≠ I152), S141 (= S154), Y154 (= Y167), K158 (= K171), G185 (= G198), V187 (≠ I200), T189 (= T202), M191 (≠ I204)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
32% identity, 98% coverage: 5:258/260 of query aligns to 2:249/252 of 1vl8B
- active site: G17 (= G20), S143 (= S154), I154 (= I164), Y157 (= Y167), K161 (= K171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G16), R16 (≠ S19), G17 (= G20), L18 (= L21), S37 (= S40), R38 (= R41), C63 (≠ L65), D64 (= D66), V65 (= V67), A91 (≠ N93), A92 (≠ S94), G93 (= G95), I94 (≠ V96), V114 (≠ T116), I141 (= I152), S143 (= S154), Y157 (= Y167), K161 (= K171), P187 (= P197), G188 (= G198), Y190 (≠ I200), T192 (= T202), M194 (≠ I204), T195 (≠ N205)
6pejA Structure of sorbitol dehydrogenase from sinorhizobium meliloti 1021 bound to sorbitol
33% identity, 97% coverage: 7:257/260 of query aligns to 4:253/257 of 6pejA
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
32% identity, 98% coverage: 5:258/260 of query aligns to 3:252/255 of 5itvA
- active site: G18 (= G20), S141 (= S154), Y154 (= Y167), K158 (= K171)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G16), S17 (= S19), G18 (= G20), I19 (≠ L21), D38 (≠ S40), I39 (= I43), T61 (≠ L65), I63 (≠ V67), N89 (= N93), G91 (= G95), T139 (≠ I152), S141 (= S154), Y154 (= Y167), K158 (= K171), P184 (= P197), G185 (= G198), I186 (≠ Y199), I187 (= I200)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
34% identity, 98% coverage: 3:257/260 of query aligns to 2:245/254 of 3o03A
- active site: G22 (= G20), S147 (= S154), V157 (≠ I164), Y160 (= Y167), K164 (= K171)
- binding calcium ion: S147 (= S154), M148 (= M155), P190 (= P197)
- binding D-gluconic acid: I99 (≠ S97), R101 (≠ T99), S147 (= S154), M149 (≠ A156), R154 (≠ L161), Y160 (= Y167)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G16), Y21 (≠ S19), G22 (= G20), I23 (≠ L21), D42 (≠ S40), I43 (≠ R41), L47 (≠ K45), D68 (= D66), V69 (= V67), N95 (= N93), A96 (≠ S94), G97 (= G95), I145 (= I152), Y160 (= Y167), K164 (= K171), P190 (= P197)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
34% identity, 98% coverage: 5:258/260 of query aligns to 1:248/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), Q15 (≠ S19), G16 (= G20), I17 (≠ L21), D36 (≠ S40), V63 (= V67), N89 (= N93), A91 (≠ G95), S94 (≠ T98), I142 (= I152), S143 (≠ A153), S144 (= S154), Y157 (= Y167), K161 (= K171), P187 (= P197), H188 (≠ G198), I190 (= I200), I194 (= I204)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
35% identity, 97% coverage: 7:258/260 of query aligns to 5:246/249 of 3uf0A
- active site: G18 (= G20), S141 (= S154), V151 (≠ I164), Y154 (= Y167), K158 (= K171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G16), S17 (= S19), G18 (= G20), I19 (≠ L21), R39 (= R42), D63 (= D69), L64 (≠ H70), N89 (= N93), G91 (= G95), I92 (≠ V96), I139 (= I152), A140 (= A153), S141 (= S154), Y154 (= Y167), K158 (= K171), P184 (= P197), G185 (= G198), V187 (≠ I200), T189 (= T202), N191 (≠ E203), T192 (≠ I204)
6j7uA Crystal structure of blue fluorescent protein from metagenomic library in complex with NADPH (see paper)
34% identity, 98% coverage: 6:259/260 of query aligns to 2:246/247 of 6j7uA
- active site: G16 (= G20), S142 (= S154), Y156 (= Y167)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (= S18), R15 (≠ S19), I17 (≠ L21), Y36 (vs. gap), V37 (= V37), S38 (≠ L38), S41 (≠ R41), D65 (= D66), S66 (≠ V67), N92 (= N93), A93 (≠ S94), G94 (= G95), I115 (≠ T116), G141 (≠ A153), S142 (= S154), Y156 (= Y167), K160 (= K171), P186 (= P197), T191 (= T202), M193 (≠ I204), N194 (= N205)
4hp8B Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound NADP
33% identity, 97% coverage: 7:258/260 of query aligns to 6:243/246 of 4hp8B
- active site: G19 (= G20), S138 (= S154), V148 (≠ I164), Y151 (= Y167), K155 (= K171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), N17 (≠ S18), T18 (≠ S19), G19 (= G20), L20 (= L21), R40 (= R41), R41 (= R42), D63 (= D66), F64 (≠ V67), N85 (= N93), G87 (= G95), I88 (≠ V96), I136 (= I152), Y151 (= Y167), K155 (= K171), P181 (= P197), G182 (= G198), I184 (= I200), T186 (= T202), N188 (≠ I204), T189 (≠ N205)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
31% identity, 97% coverage: 7:258/260 of query aligns to 5:258/261 of 6zzsD
- active site: G18 (= G20), S143 (= S154), Y156 (= Y167)
- binding nicotinamide-adenine-dinucleotide: G14 (= G16), S17 (= S19), I19 (≠ L21), D38 (≠ S40), M39 (≠ R41), D64 (= D66), V65 (= V67), N91 (= N93), A92 (≠ S94), G93 (= G95), M141 (≠ I152), A142 (= A153), S143 (= S154), Y156 (= Y167), K160 (= K171), P186 (= P197), G187 (= G198), V189 (≠ I200), T191 (= T202), L193 (≠ I204)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ S97), S143 (= S154), N145 (≠ A156), K153 (≠ I164), Y156 (= Y167), Q197 (vs. gap)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
31% identity, 97% coverage: 7:258/260 of query aligns to 4:257/260 of 6zzqA
- active site: G17 (= G20), S142 (= S154), Y155 (= Y167)
- binding acetoacetic acid: Q94 (≠ S97), S142 (= S154), K152 (≠ I164), Y155 (= Y167), Q196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G13 (= G16), S16 (= S19), G17 (= G20), I18 (≠ L21), D37 (≠ S40), M38 (≠ R41), D63 (= D66), V64 (= V67), N90 (= N93), A91 (≠ S94), G92 (= G95), M140 (≠ I152), A141 (= A153), S142 (= S154), Y155 (= Y167), K159 (= K171), Y187 (= Y199), V188 (≠ I200), T190 (= T202)
P50162 Tropinone reductase 1; Tropine dehydrogenase; Tropinone reductase I; TR-I; EC 1.1.1.206 from Datura stramonium (Jimsonweed) (Common thornapple) (see paper)
33% identity, 97% coverage: 7:258/260 of query aligns to 19:267/273 of P50162
- 25:49 (vs. 13:37, 40% identical) binding
- S158 (= S154) binding
- Y171 (= Y167) active site, Proton acceptor
1ae1B Tropinone reductase-i complex with NADP (see paper)
33% identity, 97% coverage: 7:258/260 of query aligns to 4:252/258 of 1ae1B
- active site: G17 (= G20), S143 (= S154), V153 (≠ I164), Y156 (= Y167), K160 (= K171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G16), S15 (= S18), K16 (≠ S19), G17 (= G20), I18 (≠ L21), S37 (= S40), R38 (= R41), C62 (≠ I63), D63 (≠ E64), L64 (= L65), N91 (= N93), A92 (≠ S94), S143 (= S154), Y156 (= Y167), K160 (= K171), P186 (= P197), I189 (= I200), T191 (vs. gap), L193 (vs. gap), V194 (vs. gap)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
31% identity, 98% coverage: 5:258/260 of query aligns to 3:224/227 of 5itvD
- active site: G18 (= G20), S141 (= S154), Y154 (= Y167), K158 (= K171)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G16), S17 (= S19), G18 (= G20), I19 (≠ L21), D38 (≠ S40), I39 (= I43), T61 (≠ L65), D62 (= D66), I63 (≠ V67), N89 (= N93), T139 (≠ I152), S141 (= S154), Y154 (= Y167), K158 (= K171), P184 (= P197), G185 (= G198), I187 (= I200)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
35% identity, 95% coverage: 7:252/260 of query aligns to 2:236/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), M16 (≠ L21), D35 (≠ S40), I36 (≠ R41), I62 (≠ V67), N88 (= N93), G90 (= G95), I138 (= I152), S140 (= S154), Y152 (= Y167), K156 (= K171), I185 (= I200)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
35% identity, 95% coverage: 7:252/260 of query aligns to 3:237/248 of Q9KJF1
- S15 (= S19) binding
- D36 (≠ S40) binding
- D62 (= D66) binding
- I63 (≠ V67) binding
- N89 (= N93) binding
- Y153 (= Y167) binding
- K157 (= K171) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
32% identity, 95% coverage: 10:257/260 of query aligns to 8:242/252 of 6vspB
Query Sequence
>Ac3H11_148 FitnessBrowser__acidovorax_3H11:Ac3H11_148
MAYSIDLSGRVAFITGASSGLGAQFARTLARAGAGVVLASRRIEKLKELRARIEGEGGDA
HVIELDVTDHASIKSAVAHAETEMGSIDILINNSGVSTTQRLQDVTPEDYDFIFDTNVKG
AFFVAQEVGKRMLARSRGAAPGSFTGGRIINIASMAGLKVLPQIGAYCMSKAAVVQMTRA
MAMEWGKFGINTNAICPGYIDTEINHHHWDTEQGQKLIAMLPRKRVGSPQDLDALLVMLA
SDQSHFINGAVIAADDGFAV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory