Comparing Ac3H11_1482 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC 4.1.2.n4) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7et9A Crystal structure of abhpai-zn-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
60% identity, 91% coverage: 7:254/274 of query aligns to 6:252/254 of 7et9A
7ethA Crystal structure of abhpai-zn-pyruvate-propionaldehyde complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
60% identity, 91% coverage: 7:254/274 of query aligns to 4:250/251 of 7ethA
7etiA Crystal structure of abhpai-zn-pyruvate-4-hydroxybenzaldehyde complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
60% identity, 91% coverage: 7:254/274 of query aligns to 6:252/253 of 7etiA
7etfA Crystal structure of abhpai-mn-pyruvate-succinic semialdehyde complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
60% identity, 91% coverage: 7:254/274 of query aligns to 6:252/253 of 7etfA
7eteA Crystal structure of abhpai-mg-(4r)-kdgal complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
60% identity, 91% coverage: 7:254/274 of query aligns to 6:252/253 of 7eteA
7etdA Crystal structure of abhpai-zn-(4s)-kdglu complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
60% identity, 91% coverage: 7:254/274 of query aligns to 6:252/253 of 7etdA
7etcA Crystal structure of abhpai-zn-(4r)-kdgal complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
60% identity, 91% coverage: 7:254/274 of query aligns to 6:252/253 of 7etcA
7etbA Crystal structure of abhpai-mn-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
60% identity, 91% coverage: 7:254/274 of query aligns to 6:252/253 of 7etbA
7etaA Crystal structure of abhpai-co-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
60% identity, 91% coverage: 7:254/274 of query aligns to 6:252/253 of 7etaA
Q47098 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase; 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase; HHED aldolase; 4-hydroxy-2-ketoheptane-1,7-dioate aldolase; HKHD aldolase; EC 4.1.2.52 from Escherichia coli (see 3 papers)
61% identity, 93% coverage: 6:261/274 of query aligns to 2:257/262 of Q47098
2v5kA Class ii aldolase hpch - magnesium - oxamate complex (see paper)
62% identity, 91% coverage: 6:255/274 of query aligns to 11:260/260 of 2v5kA
4b5vA Crystal structures of divalent metal dependent pyruvate aldolase, hpai, in complex with 4-hydroxyl-2-ketoheptane-1,7-dioate (see paper)
62% identity, 91% coverage: 6:255/274 of query aligns to 2:251/251 of 4b5vA
4b5tA Crystal structures of divalent metal dependent pyruvate aldolase, hpai, in complex with ketobutyrate (see paper)
62% identity, 91% coverage: 6:255/274 of query aligns to 2:251/251 of 4b5tA
4b5sA Crystal structures of divalent metal dependent pyruvate aldolase, hpai, in complex with pyruvate (see paper)
62% identity, 91% coverage: 6:255/274 of query aligns to 2:251/251 of 4b5sA
P76469 2-keto-3-deoxy-L-rhamnonate aldolase; KDR aldolase; 2-dehydro-3-deoxyrhamnonate aldolase; 2-keto-3-deoxy acid sugar aldolase; EC 4.1.2.53 from Escherichia coli (strain K12) (see paper)
54% identity, 88% coverage: 1:242/274 of query aligns to 1:242/267 of P76469
2vwtA Crystal structure of yfau, a metal ion dependent class ii aldolase from escherichia coli k12 - mg-pyruvate product complex (see paper)
54% identity, 88% coverage: 1:242/274 of query aligns to 1:242/256 of 2vwtA
1dxfA 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli in complex with pyruvate (see paper)
44% identity, 91% coverage: 7:256/274 of query aligns to 5:253/253 of 1dxfA
1dxeA 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli (see paper)
44% identity, 91% coverage: 7:256/274 of query aligns to 5:253/253 of 1dxeA
P23522 5-keto-4-deoxy-D-glucarate aldolase; KDGluc aldolase; KDGlucA; 2-dehydro-3-deoxy-D-glucarate aldolase; 2-keto-3-deoxy-D-glucarate aldolase; 5-dehydro-4-deoxy-D-glucarate aldolase; Alpha-keto-beta-deoxy-D-glucarate aldolase; EC 4.1.2.20 from Escherichia coli (strain K12) (see paper)
44% identity, 91% coverage: 7:256/274 of query aligns to 8:256/256 of P23522
8adqA Crystal structure of holo-swhpa-mg (hydroxy ketone aldolase) from sphingomonas wittichii rw1 in complex with hydroxypyruvate and d- glyceraldehyde (see paper)
31% identity, 89% coverage: 6:250/274 of query aligns to 2:245/252 of 8adqA
>Ac3H11_1482 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC 4.1.2.n4)
MMQIPNNRFRNALREGQPQIGLWVGLADANAAEALAGCGFDWLLLDGEHAPNDVRSVLDQ
LRAVAPYPAHPVVRPVQADVALVKQYLDVGAQTLLIPMVDTPEQAALMVRAMRYAPEGIR
GMGAALARASRWNQVEDYLNCANGEMCLLVQAETPLAMQNLQAIAATDGVDGVFFGPADL
SASMGYRGQASHPAVQRAILEGIATVRAVGKAPGILMADRQLAQSYLDAGALFVAVGVDT
TLLVRSATELARSFGRNSAPVPTRVPLAGGGNPY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory