Comparing Ac3H11_1487 5-carboxymethyl-2-oxo-hex-3- ene-1,7-dioate decarboxylase (EC 4.1.1.68) / 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase (EC 5.3.3.-) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1gttA Crystal structure of hpce (see paper)
56% identity, 83% coverage: 40:251/255 of query aligns to 219:418/421 of 1gttA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
40% identity, 87% coverage: 27:248/255 of query aligns to 45:248/252 of 3qdfA
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
39% identity, 82% coverage: 40:247/255 of query aligns to 89:301/303 of 8sutA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
39% identity, 82% coverage: 40:247/255 of query aligns to 88:300/303 of 8skyB
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
36% identity, 83% coverage: 43:254/255 of query aligns to 70:290/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
36% identity, 83% coverage: 43:254/255 of query aligns to 70:290/290 of 8gsrA
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
38% identity, 76% coverage: 46:240/255 of query aligns to 14:206/216 of 6sbiA
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
37% identity, 76% coverage: 46:240/255 of query aligns to 15:207/218 of 6fogA
Sites not aligning to the query:
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
37% identity, 76% coverage: 46:240/255 of query aligns to 20:212/224 of Q6P587
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
38% identity, 83% coverage: 37:247/255 of query aligns to 65:274/277 of 6iymA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
37% identity, 80% coverage: 46:248/255 of query aligns to 70:277/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
37% identity, 80% coverage: 46:248/255 of query aligns to 70:277/280 of 6j5xA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
34% identity, 92% coverage: 14:248/255 of query aligns to 34:267/269 of 4dbhA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
37% identity, 71% coverage: 42:223/255 of query aligns to 61:229/265 of 3r6oA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
33% identity, 80% coverage: 46:248/255 of query aligns to 72:276/279 of 6v77B
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
35% identity, 94% coverage: 10:248/255 of query aligns to 50:261/264 of 6jvwB
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
32% identity, 82% coverage: 41:248/255 of query aligns to 21:231/233 of 6j5yA
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
31% identity, 78% coverage: 40:238/255 of query aligns to 12:210/224 of 3v77A
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
26% identity, 75% coverage: 46:237/255 of query aligns to 11:222/247 of 1nkqA
3bqbX Hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase (see paper)
29% identity, 58% coverage: 72:220/255 of query aligns to 113:256/291 of 3bqbX
>Ac3H11_1487 5-carboxymethyl-2-oxo-hex-3- ene-1,7-dioate decarboxylase (EC 4.1.1.68) / 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase (EC 5.3.3.-)
MKKARVAYAGAIHEATPHGEQIRLADGRVLEQGEVVWLPPFEVGTIIALGLNYADHLKEL
SGELTVTTKDEPLVFLKGPGALIGHNGQTRRPADAAFMHYECELAVVIGKTARGVKKADA
LQHVAGYTVCNDYAIRDYLENWYRPNLRVKNRDTCTVLGPWFVDAADVPDPHDLQLRTLV
NGQVVQQGHTGNMVNDIAELIEYLSGFMTLRAGDVILTGTPEGVVNVSVGDQVVTEIDGI
GRLVNTIVGDEAFGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory