SitesBLAST
Comparing Ac3H11_1534 FitnessBrowser__acidovorax_3H11:Ac3H11_1534 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ey5B Lbcats
69% identity, 91% coverage: 11:398/425 of query aligns to 1:382/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H91), K82 (= K92), Q109 (= Q119), S185 (≠ T195), G227 (= G243), G229 (= G245), S230 (= S246), N231 (= N247), E345 (= E361), S371 (= S387), G372 (= G388)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
62% identity, 92% coverage: 13:402/425 of query aligns to 3:386/388 of 5dw0A
- active site: K82 (= K92), E104 (= E114), S371 (= S387)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H91), K82 (= K92), T105 (= T115), G106 (= G116), A107 (= A117), Q109 (= Q119), H110 (= H120), S185 (≠ T195), G227 (= G243), G229 (= G245), S230 (= S246), N231 (= N247), G298 (= G314), D300 (= D316), E345 (= E361), S371 (= S387)
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
62% identity, 92% coverage: 13:402/425 of query aligns to 3:386/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
62% identity, 92% coverage: 13:402/425 of query aligns to 3:386/386 of 1v8zA
- active site: K82 (= K92), E104 (= E114), S371 (= S387)
- binding pyridoxal-5'-phosphate: H81 (= H91), K82 (= K92), Q109 (= Q119), S185 (≠ T195), G227 (= G243), G228 (= G244), G229 (= G245), S230 (= S246), N231 (= N247), E345 (= E361), S371 (= S387), G372 (= G388)
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
62% identity, 92% coverage: 13:402/425 of query aligns to 3:384/394 of 5ixjD
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
61% identity, 92% coverage: 13:401/425 of query aligns to 3:385/385 of 6am8B
- active site: K82 (= K92), E104 (= E114), S371 (= S387)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H91), K82 (= K92), E104 (= E114), T105 (= T115), G106 (= G116), A107 (= A117), Q109 (= Q119), H110 (= H120), L161 (= L171), S185 (≠ T195), V187 (≠ A197), G227 (= G243), G228 (= G244), G229 (= G245), S230 (= S246), N231 (= N247), G298 (= G314), Y301 (= Y317), E345 (= E361), S371 (= S387), G372 (= G388)
- binding tryptophan: P12 (≠ S22), L169 (≠ M179), S274 (≠ L290), H275 (= H291)
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
62% identity, 92% coverage: 13:401/425 of query aligns to 3:383/383 of 5t6mA
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
62% identity, 91% coverage: 13:397/425 of query aligns to 3:380/383 of 5dw3A
- active site: K82 (= K92), E104 (= E114), S370 (= S387)
- binding tryptophan: K82 (= K92), E104 (= E114), T105 (= T115), G106 (= G116), A107 (= A117), Q109 (= Q119), H110 (= H120), S185 (≠ T195), G228 (= G244), Y300 (= Y317)
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
61% identity, 91% coverage: 13:397/425 of query aligns to 3:381/384 of 7rnpA
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
61% identity, 92% coverage: 13:401/425 of query aligns to 3:383/383 of 5vm5D
- active site: K82 (= K92), E104 (= E114), S369 (= S387)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H91), K82 (= K92), T105 (= T115), G106 (= G116), A107 (= A117), Q109 (= Q119), H110 (= H120), S185 (≠ T195), G227 (= G243), G229 (= G245), S230 (= S246), N231 (= N247), G296 (= G314), E343 (= E361), S369 (= S387)
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
61% identity, 92% coverage: 13:401/425 of query aligns to 3:385/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H91), K82 (= K92), T105 (= T115), G106 (= G116), A107 (= A117), Q109 (= Q119), H110 (= H120), S185 (≠ T195), G227 (= G243), G229 (= G245), S230 (= S246), N231 (= N247), G298 (= G314), E345 (= E361), S371 (= S387)
6cuzA Engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate (see paper)
62% identity, 91% coverage: 13:397/425 of query aligns to 3:381/383 of 6cuzA
- binding (2E)-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]pent-2-enoic acid: H81 (= H91), K82 (= K92), T105 (= T115), G106 (= G116), A107 (= A117), Q109 (= Q119), H110 (= H120), S185 (≠ T195), G227 (= G243), G229 (= G245), S230 (= S246), N231 (= N247), G298 (= G314), E345 (= E361), S371 (= S387)
5ocwB Structure of mycobacterium tuberculosis tryptophan synthase in space group f222 (see paper)
59% identity, 94% coverage: 5:402/425 of query aligns to 3:397/399 of 5ocwB
- active site: K93 (= K92), E115 (= E114), S382 (= S387)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H92 (= H91), K93 (= K92), T116 (= T115), G117 (= G116), A118 (= A117), Q120 (= Q119), H121 (= H120), T196 (= T195), G238 (= G243), G240 (= G245), S241 (= S246), N242 (= N247), G309 (= G314), E356 (= E361), S382 (= S387)
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
59% identity, 94% coverage: 5:402/425 of query aligns to 8:402/406 of 5tciH
- active site: K98 (= K92), E120 (= E114), S387 (= S387)
- binding (2R,3S,4R)-3-(2'-fluoro[1,1'-biphenyl]-4-yl)-4-(hydroxymethyl)azetidine-2-carbonitrile: P28 (≠ S22), L31 (= L25), Y197 (= Y191), F199 (≠ I193), P205 (= P199), F208 (≠ Y202), H291 (= H291)
6uapB Crystal structure of tryptophan synthase from m. Tuberculosis - open form with brd6309 bound
59% identity, 94% coverage: 5:402/425 of query aligns to 7:401/405 of 6uapB
- active site: K97 (= K92), E119 (= E114), S386 (= S387)
- binding (2R,3S,4R)-3-(4'-chloro-2',6'-difluoro[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: I180 (≠ L175), N181 (= N176), F184 (≠ M179), Y196 (= Y191), F198 (≠ I193), P204 (= P199), F207 (≠ Y202), H290 (= H291)
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
59% identity, 94% coverage: 5:402/425 of query aligns to 8:402/405 of 6u6cB
- active site: K98 (= K92), E120 (= E114), S387 (= S387)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (= H91), K98 (= K92), T121 (= T115), G122 (= G116), A123 (= A117), Q125 (= Q119), H126 (= H120), T201 (= T195), G243 (= G243), G245 (= G245), S246 (= S246), N247 (= N247), G314 (= G314), E361 (= E361), S387 (= S387)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: Y26 (≠ F20), F185 (≠ M179), W188 (= W182), Y197 (= Y191), F199 (≠ I193), G204 (= G198), P205 (= P199), H291 (= H291), G292 (= G292)
6usaB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk1-bound form (see paper)
59% identity, 94% coverage: 5:402/425 of query aligns to 7:401/404 of 6usaB
- active site: K97 (= K92), E119 (= E114), S386 (= S387)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H91), K97 (= K92), T120 (= T115), G121 (= G116), A122 (= A117), G123 (= G118), Q124 (= Q119), H125 (= H120), T200 (= T195), G242 (= G243), G244 (= G245), S245 (= S246), N246 (= N247), G313 (= G314), E360 (= E361), S386 (= S387)
- binding (3R,4R)-4-[4-(2-Chlorophenyl)piperazin-1-yl]-1,1-dioxothiolan-3-ol: F184 (≠ M179), W187 (= W182), Y196 (= Y191), F198 (≠ I193), G203 (= G198), P204 (= P199), F207 (≠ Y202), H290 (= H291), G291 (= G292)
6dweB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and brd0059-bound form
59% identity, 94% coverage: 5:402/425 of query aligns to 7:401/404 of 6dweB
- active site: K97 (= K92), E119 (= E114), S386 (= S387)
- binding (2R,3S,4R)-3-(2',6'-difluoro-4'-methyl[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: F184 (≠ M179), Y196 (= Y191), F198 (≠ I193), P204 (= P199), F207 (≠ Y202), H290 (= H291)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H91), K97 (= K92), T120 (= T115), G121 (= G116), A122 (= A117), G123 (= G118), Q124 (= Q119), H125 (= H120), T200 (= T195), G242 (= G243), G244 (= G245), S245 (= S246), N246 (= N247), G313 (= G314), E360 (= E361), S386 (= S387)
8egzB Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate
57% identity, 92% coverage: 10:399/425 of query aligns to 1:379/386 of 8egzB
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H91), K82 (= K92), T105 (= T115), G106 (= G116), A107 (= A117), Q109 (= Q119), H110 (= H120), S185 (≠ T195), G229 (= G245), S230 (= S246), N231 (= N247), G297 (= G314), E344 (= E361), S367 (= S387)
8eh0A Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate and complexed with quinoline n-oxide
57% identity, 92% coverage: 11:399/425 of query aligns to 1:378/385 of 8eh0A
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H80 (= H91), K81 (= K92), T104 (= T115), G105 (= G116), A106 (= A117), Q108 (= Q119), H109 (= H120), S184 (≠ T195), G228 (= G245), S229 (= S246), N230 (= N247), G296 (= G314), E343 (= E361), S366 (= S387), G367 (= G388)
- binding 1-oxo-1lambda~5~-quinoline: L160 (= L171), I164 (≠ L175), Y180 (= Y191), P182 (≠ I193), G183 (= G194), S184 (≠ T195), V186 (≠ A197), Y299 (= Y317)
Query Sequence
>Ac3H11_1534 FitnessBrowser__acidovorax_3H11:Ac3H11_1534
MNSYQQPDSSGHFGPYGGSFVSETLTHAIQELRDAYARYQNDPDFVAEFAYELKHFVGRP
SPVYHAARTSRELGGAQIYLKREDLNHTGAHKINNVIGQAMLARRMGKPRVIAETGAGQH
GVATATICARYGLECVVYMGSEDVKRQSPNVFRMKLLGATVVPVESGSKTLKDALNEAMR
DWVANVDNTFYIIGTVAGPHPYPMMVRDFQSVIGKESIEQMPAMLAEQKIAAEQPDAVIA
CVGGGSNAMGIFHPYIPFAKTRLIGVEAAGEGLDSGKHSASLQRGSSGVLHGNRTFILQD
ANGQITETHSISAGLDYPGVGPEHAWLQEIGRAEYVGITDQEALSAFHHLCRTEGIIPAL
ESSHAFAYALKLAPTMRPDQAILVNLSGRGDKDIGTVADLSGEDFYDRPSMRGLTVKGAP
GDAKQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory