SitesBLAST
Comparing Ac3H11_1540 FitnessBrowser__acidovorax_3H11:Ac3H11_1540 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2gn8A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp (see paper)
56% identity, 93% coverage: 11:280/290 of query aligns to 53:327/327 of 2gn8A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D61 (= D19), V62 (= V20), A81 (= A39), A82 (= A40), A83 (= A41), K85 (= K43), T100 (= T58), L123 (= L81), S124 (= S82), K139 (= K97), Y165 (= Y123), G166 (= G124), V168 (= V126), S171 (= S129), R172 (= R130)
- binding uridine-5'-diphosphate: K127 (= K85), N167 (= N125), V175 (= V133), P191 (= P147), I192 (= I148), T193 (= T149), M197 (= M153), R199 (= R155), M233 (≠ I189), R252 (= R208)
Sites not aligning to the query:
O25511 UDP-N-acetylglucosamine 4,6-dehydratase (inverting); Pseudaminic acid biosynthesis protein B; UDP-GlcNAc-inverting 4,6-dehydratase; EC 4.2.1.115 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
56% identity, 93% coverage: 11:280/290 of query aligns to 59:333/333 of O25511
- DV 67:68 (= DV 19:20) binding
- A87 (= A39) binding
- K91 (= K43) binding
- LS 129:130 (= LS 81:82) binding
- K133 (= K85) mutation K->A,E: Loss of activity.
- Y141 (= Y93) binding
- K145 (= K97) binding
- VVGSR 174:178 (≠ VMGSR 126:130) binding
Sites not aligning to the query:
- 19:22 binding
- 43:48 binding
2gnaA Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-gal (see paper)
56% identity, 93% coverage: 11:280/290 of query aligns to 55:329/329 of 2gnaA
- binding galactose-uridine-5'-diphosphate: K87 (= K43), S176 (= S132), V177 (= V133), T195 (= T149), M199 (= M153), R201 (= R155), M235 (≠ I189), R254 (= R208), E257 (= E211)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D63 (= D19), V64 (= V20), A83 (= A39), A84 (= A40), A85 (= A41), K87 (= K43), L125 (= L81), S126 (= S82), Y137 (= Y93), K141 (= K97), Y167 (= Y123), G168 (= G124), V170 (= V126)
Sites not aligning to the query:
2gn9A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glc (see paper)
56% identity, 93% coverage: 11:280/290 of query aligns to 55:329/329 of 2gn9A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D63 (= D19), V64 (= V20), A83 (= A39), A84 (= A40), A85 (= A41), K87 (= K43), L125 (= L81), S126 (= S82), K141 (= K97), Y167 (= Y123), G168 (= G124), V170 (= V126), R174 (= R130)
- binding uridine-5'-diphosphate-glucose: K87 (= K43), T127 (= T83), K129 (= K85), Y137 (= Y93), N169 (= N125), S176 (= S132), V177 (= V133), P193 (= P147), T195 (= T149), M199 (= M153), R201 (= R155), M235 (≠ I189), R254 (= R208), E257 (= E211)
Sites not aligning to the query:
2gn6A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glcnac (see paper)
56% identity, 93% coverage: 11:280/290 of query aligns to 55:329/329 of 2gn6A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D63 (= D19), V64 (= V20), A84 (= A40), A85 (= A41), K87 (= K43), S126 (= S82), Y137 (= Y93), K141 (= K97), Y167 (= Y123), G168 (= G124), V170 (= V126), S173 (= S129), R174 (= R130)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K43), D128 (= D84), K129 (= K85), N169 (= N125), G175 (= G131), S176 (= S132), V177 (= V133), P193 (= P147), I194 (= I148), M199 (= M153), R201 (= R155), M235 (≠ I189), R254 (= R208), E257 (= E211)
Sites not aligning to the query:
2gn4A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADPH and udp-glcnac (see paper)
56% identity, 93% coverage: 11:280/290 of query aligns to 55:329/329 of 2gn4A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: D63 (= D19), V64 (= V20), A83 (= A39), A84 (= A40), A85 (= A41), K87 (= K43), T102 (= T58), L125 (= L81), S126 (= S82), T127 (= T83), Y137 (= Y93), K141 (= K97), Y167 (= Y123), G168 (= G124), V170 (= V126), S173 (= S129), R174 (= R130)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K43), T127 (= T83), D128 (= D84), K129 (= K85), Y137 (= Y93), N169 (= N125), S176 (= S132), V177 (= V133), P193 (= P147), T195 (= T149), M199 (= M153), R201 (= R155), M235 (≠ I189), R254 (= R208), E257 (= E211)
Sites not aligning to the query:
3w1vA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor (see paper)
41% identity, 91% coverage: 13:276/290 of query aligns to 63:329/347 of 3w1vA
- binding [(2R,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,4-bis(oxidanyl)oxan-2-yl]methylimino-azanylidene-azanium: K93 (= K43), Q94 (= Q44), N175 (= N125), S179 (= S129), R180 (= R130), S182 (= S132), V183 (= V133), L186 (≠ F136), T198 (≠ P147), I199 (= I148), T200 (= T149), M204 (= M153), R206 (= R155), V240 (≠ I189), R263 (= R208), E266 (= E211)
4g5hA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with by-product (see paper)
41% identity, 91% coverage: 13:276/290 of query aligns to 63:329/346 of 4g5hA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D69 (= D19), V70 (= V20), A89 (= A39), A90 (= A40), A91 (= A41), K93 (= K43), L131 (= L81), T133 (= T83), K147 (= K97), Y173 (= Y123)
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: Q94 (= Q44), V95 (= V45), K135 (= K85), N175 (= N125), S182 (= S132), V183 (= V133), L186 (≠ F136), T198 (≠ P147), T200 (= T149), M204 (= M153), V240 (≠ I189), R263 (= R208), E266 (= E211), Y278 (≠ A223), S313 (≠ G259), Y314 (≠ F260), E315 (≠ A261), Y316 (= Y262), N320 (= N267)
Sites not aligning to the query:
3vvcA Crystal structure of capsular polysaccharide synthesizing enzyme cape , k126e, in apo form (see paper)
44% identity, 77% coverage: 13:235/290 of query aligns to 55:282/318 of 3vvcA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D61 (= D19), V62 (= V20), R63 (= R21), A81 (= A39), A82 (= A40), A83 (= A41), K85 (= K43), S124 (= S82), T125 (= T83), K139 (= K97), Y165 (= Y123), G166 (= G124)
Sites not aligning to the query:
4j2oC Crystal structure of NADP-bound wbjb from a. Baumannii community strain d1279779 (see paper)
43% identity, 77% coverage: 13:235/290 of query aligns to 54:282/316 of 4j2oC
Sites not aligning to the query:
6bwcC X-ray structure of pen from bacillus thuringiensis (see paper)
38% identity, 77% coverage: 13:235/290 of query aligns to 57:289/327 of 6bwcC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D63 (= D19), I64 (≠ V20), V83 (≠ A39), A84 (= A40), K87 (= K43), T125 (≠ L81), S127 (≠ T83), Y137 (= Y93), K141 (= K97), F167 (≠ Y123), V170 (= V126), S173 (= S129), R174 (= R130)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K43), H88 (≠ Q44), S127 (≠ T83), N128 (≠ D84), Y137 (= Y93), N169 (= N125), S176 (= S132), V177 (= V133), L180 (≠ F136), T192 (≠ P147), T194 (= T149), M198 (= M153), R200 (= R155), L234 (≠ I189), E265 (= E211)
Sites not aligning to the query:
3vvbA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form (see paper)
34% identity, 77% coverage: 13:235/290 of query aligns to 53:236/270 of 3vvbA
Sites not aligning to the query:
4tqgA Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534 (see paper)
34% identity, 78% coverage: 13:237/290 of query aligns to 53:265/297 of 4tqgA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: D59 (= D19), I60 (≠ V20), A81 (= A39), A82 (= A40), A83 (= A41), K85 (= K43), V128 (≠ L81), Y140 (= Y93), K144 (= K97), Y168 (= Y123), G169 (= G124), V171 (= V126)
Sites not aligning to the query:
5bjuA X-ray structure of the pglf dehydratase from campylobacter jejuni in complex with udp and NAD(h) (see paper)
33% identity, 67% coverage: 34:226/290 of query aligns to 99:294/340 of 5bjuA
- binding nicotinamide-adenine-dinucleotide: A104 (= A39), A105 (= A40), A106 (= A41), K108 (= K43), N123 (≠ T58), I146 (≠ L81), K162 (= K97), F184 (≠ Y123), G185 (= G124), N186 (= N125), V187 (= V126), S190 (= S129), S191 (≠ R130)
- binding uridine-5'-diphosphate: K150 (= K85), N186 (= N125), S193 (= S132), V194 (= V133), T209 (≠ P147), L210 (≠ I148), T211 (= T149), I215 (≠ M153), R217 (= R155), E279 (= E211)
Sites not aligning to the query:
5bjvA X-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n- acrtylglucosamine (see paper)
32% identity, 67% coverage: 34:226/290 of query aligns to 99:294/339 of 5bjvA
- binding nicotinamide-adenine-dinucleotide: A104 (= A39), A105 (= A40), A106 (= A41), K108 (= K43), N123 (≠ T58), I146 (≠ L81), K162 (= K97), F184 (≠ Y123), G185 (= G124), N186 (= N125), V187 (= V126), S190 (= S129), S191 (≠ R130)
- binding uridine-diphosphate-n-acetylglucosamine: K108 (= K43), H109 (≠ Q44), T148 (= T83), G185 (= G124), N186 (= N125), S193 (= S132), V194 (= V133), T209 (≠ P147), L210 (≠ I148), T211 (= T149), I215 (≠ M153), R217 (= R155), R276 (= R208), E279 (= E211)
Sites not aligning to the query:
3pvzA Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
30% identity, 52% coverage: 34:184/290 of query aligns to 109:256/372 of 3pvzA
Sites not aligning to the query:
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
37% identity, 30% coverage: 6:91/290 of query aligns to 50:135/322 of 1r66A
- active site: T127 (= T83), D128 (= D84), E129 (≠ K85)
- binding nicotinamide-adenine-dinucleotide: D63 (= D19), I64 (≠ V20), F83 (≠ A39), A84 (= A40), A85 (= A41), S87 (≠ K43), T102 (= T58), V125 (≠ L81), S126 (= S82)
- binding thymidine-5'-diphosphate: H88 (≠ Q44), E129 (≠ K85)
Sites not aligning to the query:
- active site: 151, 155
- binding nicotinamide-adenine-dinucleotide: 10, 11, 12, 37, 38, 39, 40, 43, 151, 155, 181
- binding thymidine-5'-diphosphate: 180, 190, 191, 206, 208, 215, 250, 274, 277
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
36% identity, 30% coverage: 6:91/290 of query aligns to 50:135/322 of 1r6dA
- active site: T127 (= T83), N128 (≠ D84), Q129 (≠ K85)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (≠ K43), H88 (≠ Q44), T127 (= T83), N128 (≠ D84), Q129 (≠ K85)
- binding nicotinamide-adenine-dinucleotide: D63 (= D19), I64 (≠ V20), F83 (≠ A39), A84 (= A40), A85 (= A41), S87 (≠ K43), T102 (= T58), V125 (≠ L81), S126 (= S82)
Sites not aligning to the query:
- active site: 151, 155
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: 151, 180, 190, 191, 206, 208, 215, 250, 274, 277, 281
- binding nicotinamide-adenine-dinucleotide: 10, 11, 12, 37, 38, 39, 40, 42, 43, 151, 155, 181
Q9SYM5 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1; Protein REPRESSOR OF LRX1 1; Rhamnose biosynthetic enzyme 1; AtRHM1; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
26% identity, 47% coverage: 1:135/290 of query aligns to 47:214/669 of Q9SYM5
Sites not aligning to the query:
- 283 R→K: In rol1-2; Abolishes dehydratase activity in vitro (PubMed:16766693). Induces aberrant accumulation of flavonols leading to alterations in plant growth and cell shape formation (PubMed:18567791, PubMed:18757557).
8sk0B Crystal structure of evds6 decarboxylase in ligand bound state (see paper)
30% identity, 56% coverage: 18:179/290 of query aligns to 67:244/330 of 8sk0B
- binding nicotinamide-adenine-dinucleotide: D68 (= D19), I69 (≠ V20), F88 (≠ A39), A89 (= A40), A90 (= A41), T92 (≠ K43), T107 (= T58), V130 (≠ L81), Y156 (= Y93), K160 (= K97), G184 (= G124), N186 (≠ V126)
Sites not aligning to the query:
Query Sequence
>Ac3H11_1540 FitnessBrowser__acidovorax_3H11:Ac3H11_1540
MQQVFPASQFPCLRYFIGDVRDEARLRRALEGIDIVVHAAALKQVPAAEYNPFECIKTNV
LGAQNLIEACLSNGVQRVVALSTDKAAAPVNLYGATKLCSDKLFIAANNIKGNRDIRFSV
VRYGNVMGSRGSVIPFFLEKRKSGALPITDPRMTRFNISLQEGVDMVLWSIEHAWGGEVL
VPKIPSYRITDVATAVAPNCRQEIIGIRPGEKIHEEMITSSDAASTVDLGSYYAILPLAG
QFTLKEYCAKTGAKPVEPGFAYDSGKNPDFLSVDQLCALIEKYVASPTTM
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory