Comparing Ac3H11_1553 FitnessBrowser__acidovorax_3H11:Ac3H11_1553 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
1wyuB Crystal structure of glycine decarboxylase (p-protein) of the glycine cleavage system, in holo form (see paper)
51% identity, 88% coverage: 58:483/486 of query aligns to 41:457/473 of 1wyuB
6i35A Crystal structure of human glycine decarboxylase (p-protein) bound with pyridoxyl-glycine-5'-monophosphate
41% identity, 80% coverage: 62:450/486 of query aligns to 478:865/953 of 6i35A
Sites not aligning to the query:
6i34B Crystal structure of neanderthal glycine decarboxylase (p-protein)
41% identity, 80% coverage: 62:450/486 of query aligns to 480:867/954 of 6i34B
Sites not aligning to the query:
6i33A Crystal structure of human glycine decarboxylase (p-protein)
41% identity, 80% coverage: 62:450/486 of query aligns to 479:862/950 of 6i33A
Sites not aligning to the query:
P15505 Glycine dehydrogenase (decarboxylating), mitochondrial; Glycine cleavage system P protein; Glycine decarboxylase; Glycine dehydrogenase (aminomethyl-transferring); EC 1.4.4.2 from Gallus gallus (Chicken) (see paper)
41% identity, 80% coverage: 62:450/486 of query aligns to 514:901/1004 of P15505
Q94B78 Glycine dehydrogenase (decarboxylating) 1, mitochondrial; Glycine cleavage system P protein 1; Glycine decarboxylase 1; Glycine decarboxylase P-protein 1; AtGLDP1; Glycine dehydrogenase (aminomethyl-transferring) 1; EC 1.4.4.2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
41% identity, 80% coverage: 62:450/486 of query aligns to 550:940/1037 of Q94B78
Sites not aligning to the query:
4lhdA Crystal structure of synechocystis sp. Pcc 6803 glycine decarboxylase (p-protein), holo form with pyridoxal-5'-phosphate and glycine, closed flexible loop (see paper)
39% identity, 83% coverage: 62:462/486 of query aligns to 488:877/952 of 4lhdA
Sites not aligning to the query:
6i33B Crystal structure of human glycine decarboxylase (p-protein)
40% identity, 80% coverage: 62:450/486 of query aligns to 480:838/925 of 6i33B
Sites not aligning to the query:
>Ac3H11_1553 FitnessBrowser__acidovorax_3H11:Ac3H11_1553
MWRMLARVCGSPEMSATSPSQSIIDLHRPGAASDVFAGRVLVSPPLPSFARQRTVIGLPE
VSEVDVVRHFTRLSQESHGVDNGPYPLGSCTMKYNPKRNDELARLPGFVSAHPMQDVDTL
RGVWELYERLQSMVNEVTGMDACCLAPAAGAHGELAGLLVIRKYFAQLGVIRPVVLVPDS
AHGTNPASAAMAGFDCRIVPSDLKGRVDMVSLREMLTPDVAAFMLTNPSTLGLFEDQIVE
IADAVHANGSLLYYDGANLNALMGIVRPGDMGFDVVHVNVHKTFSTPHGGGGPGAGPVAV
KAGLAAYLPSPVVVRKDGVAQPDGDLPLSIGRMKSFHGHVGVLLRAYGYLRTMGARGLRE
ASENAVLNANYLQHRLAPMLPPVYRQFCKHETLLSGEKLNTSARQFAKRLIDYGIHPPTL
VGAGCVYFPGDLKSAMLIEPTETETKASLDYQVEIFERVFNEDATDEALVGRAPLSRKIA
RIDLKN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory