Comparing Ac3H11_1554 FitnessBrowser__acidovorax_3H11:Ac3H11_1554 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
1wyvA Crystal structure of glycine decarboxylase (p-protein) of the glycine cleavage system, in inhibitor-bound form (see paper)
39% identity, 98% coverage: 8:456/457 of query aligns to 3:435/437 of 1wyvA
1wyuA Crystal structure of glycine decarboxylase (p-protein) of the glycine cleavage system, in holo form (see paper)
39% identity, 98% coverage: 8:456/457 of query aligns to 3:435/437 of 1wyuA
4lhdA Crystal structure of synechocystis sp. Pcc 6803 glycine decarboxylase (p-protein), holo form with pyridoxal-5'-phosphate and glycine, closed flexible loop (see paper)
34% identity, 82% coverage: 14:388/457 of query aligns to 29:399/952 of 4lhdA
Sites not aligning to the query:
6i35A Crystal structure of human glycine decarboxylase (p-protein) bound with pyridoxyl-glycine-5'-monophosphate
32% identity, 76% coverage: 14:362/457 of query aligns to 25:361/953 of 6i35A
Sites not aligning to the query:
6i33A Crystal structure of human glycine decarboxylase (p-protein)
32% identity, 76% coverage: 14:362/457 of query aligns to 25:361/950 of 6i33A
Sites not aligning to the query:
6i33B Crystal structure of human glycine decarboxylase (p-protein)
32% identity, 76% coverage: 14:362/457 of query aligns to 23:359/925 of 6i33B
Sites not aligning to the query:
P15505 Glycine dehydrogenase (decarboxylating), mitochondrial; Glycine cleavage system P protein; Glycine decarboxylase; Glycine dehydrogenase (aminomethyl-transferring); EC 1.4.4.2 from Gallus gallus (Chicken) (see paper)
32% identity, 76% coverage: 15:362/457 of query aligns to 64:393/1004 of P15505
Sites not aligning to the query:
6i34B Crystal structure of neanderthal glycine decarboxylase (p-protein)
32% identity, 76% coverage: 14:362/457 of query aligns to 23:359/954 of 6i34B
Sites not aligning to the query:
Q94B78 Glycine dehydrogenase (decarboxylating) 1, mitochondrial; Glycine cleavage system P protein 1; Glycine decarboxylase 1; Glycine decarboxylase P-protein 1; AtGLDP1; Glycine dehydrogenase (aminomethyl-transferring) 1; EC 1.4.4.2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 79% coverage: 2:362/457 of query aligns to 77:429/1037 of Q94B78
Sites not aligning to the query:
>Ac3H11_1554 FitnessBrowser__acidovorax_3H11:Ac3H11_1554
MERMPTGFNVHTGSDVQSMLEVMGLDSVEQLFADVPAQVRLRRELDLPPALSEWELMRDV
RSMADMNSTVLSHTSFLGCGAYEHYIPAVVDAIVSRGEFLTAYTPYQPEMSQGLLQALFE
FQVLLGRLLGRECVNCSVYDGATALAESCWMMCSASGKRRVVVAQAVWAQYREVLDTYLL
PRGVQVVYVAQDPVTGMVDAAAMANLIASGDVAGVALQSPNALGLVEDVQAVALMCSQHG
ALLTVCVNPLLCGWLEAPGALGADIVVCEGQPLGLPLSAGGPYVGIIACAKPLERYLPGR
LVGRVHDLNGQLGYALVKEDREQHVARDKATSHICSNQALNAIRVAIHLACLGERNFMRI
AQMNAANAARLRELLTSIDGVSALRSGVHFNEFAVALPVDVATFCTRMRNLGIFAGVPLE
EGLVGHGRGLLVAVTETKSLADLEAYVAHARACLRES
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory