Comparing Ac3H11_1602 FitnessBrowser__acidovorax_3H11:Ac3H11_1602 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
65% identity, 100% coverage: 1:407/408 of query aligns to 3:409/410 of P58350
6f35A Crystal structure of the aspartate aminotranferase from rhizobium meliloti (see paper)
65% identity, 98% coverage: 10:407/408 of query aligns to 2:399/400 of 6f35A
6f77A Crystal structure of the prephenate aminotransferase from rhizobium meliloti (see paper)
55% identity, 97% coverage: 13:406/408 of query aligns to 4:397/399 of 6f77A
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
55% identity, 97% coverage: 13:406/408 of query aligns to 5:398/400 of Q02635
8wkjA The crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila (see paper)
49% identity, 90% coverage: 38:404/408 of query aligns to 30:390/391 of 8wkjA
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
42% identity, 96% coverage: 15:407/408 of query aligns to 5:399/399 of 5wmhA
5wmlA Arabidopsis thaliana prephenate aminotransferase mutant- k306a (see paper)
42% identity, 96% coverage: 15:407/408 of query aligns to 6:400/404 of 5wmlA
5wmiA Arabidopsis thaliana prephenate aminotransferase mutant- t84v (see paper)
42% identity, 96% coverage: 15:407/408 of query aligns to 6:399/402 of 5wmiA
1j32A Aspartate aminotransferase from phormidium lapideum
38% identity, 96% coverage: 10:402/408 of query aligns to 1:382/388 of 1j32A
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
42% identity, 95% coverage: 15:402/408 of query aligns to 7:380/385 of Q56232
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
42% identity, 95% coverage: 15:402/408 of query aligns to 7:380/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
42% identity, 95% coverage: 15:402/408 of query aligns to 7:380/382 of 1bjwA
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
42% identity, 95% coverage: 15:402/408 of query aligns to 7:380/382 of 1b5oA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
42% identity, 95% coverage: 15:402/408 of query aligns to 7:380/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
42% identity, 95% coverage: 15:402/408 of query aligns to 7:380/382 of 1gc3A
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
40% identity, 96% coverage: 13:405/408 of query aligns to 3:383/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
40% identity, 96% coverage: 13:405/408 of query aligns to 3:383/388 of 1gd9A
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
34% identity, 95% coverage: 15:401/408 of query aligns to 13:379/384 of 1o4sB
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
30% identity, 95% coverage: 22:407/408 of query aligns to 23:398/402 of P14909
Sites not aligning to the query:
1xi9C Alanine aminotransferase from pyrococcus furiosus pfu-1397077-001
30% identity, 97% coverage: 11:405/408 of query aligns to 1:391/393 of 1xi9C
>Ac3H11_1602 FitnessBrowser__acidovorax_3H11:Ac3H11_1602
MNAPIPATAFRAADRLGAIGVSEIVRLTQEANQLKRQGQPVIVLGLGEPDFDTPAHILEA
AQQAMARGETHYTVLDGTAELKAAIQHKFKHYNGLDFQLNEITAGAGAKQILYNALMASV
NPGDEVILPAPYWTSYADMVLIAGGVPVVVPCTEANGFRITPEQLEAAITPRTRWVFINS
PSNPSGAAYSAEQLRPVLEVVERHPQVWLLADDIYEHILYDGRAFATPAAVLPSLRDRTL
TVNGVSKAYAMTGWRLGYGAGPKALIAAMAVVQSQATSCPSSISQAAAVAALTGPQDVVR
ERCQAFQDRRDLVVAALNVSPGLRCRVPEGAFYTFASCEGALGRTTPGGLLLRTDADFCA
YLLREHHVAVVPGGVLGLAPYFRISYAASTADLQEACARIQRACQALF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory