Comparing Ac3H11_161 FitnessBrowser__acidovorax_3H11:Ac3H11_161 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
90% identity, 93% coverage: 23:323/323 of query aligns to 1:301/301 of 4pdhA
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
86% identity, 94% coverage: 21:323/323 of query aligns to 2:304/304 of 4pakA
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
86% identity, 94% coverage: 21:323/323 of query aligns to 1:303/303 of 4p9kA
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
58% identity, 93% coverage: 23:323/323 of query aligns to 1:301/303 of 4pddA
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
54% identity, 93% coverage: 23:323/323 of query aligns to 1:300/301 of 4nq8B
4xeqB Crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid
39% identity, 90% coverage: 28:319/323 of query aligns to 6:298/304 of 4xeqB
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
38% identity, 92% coverage: 26:321/323 of query aligns to 8:305/310 of 7bbrA
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
38% identity, 92% coverage: 26:321/323 of query aligns to 7:304/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
38% identity, 92% coverage: 26:321/323 of query aligns to 7:304/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
38% identity, 92% coverage: 26:321/323 of query aligns to 7:304/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
38% identity, 92% coverage: 26:321/323 of query aligns to 7:304/310 of 7bcnA
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
36% identity, 83% coverage: 41:307/323 of query aligns to 18:284/300 of 4n8yA
Sites not aligning to the query:
Q128M1 Solute-binding protein Bpro_3107 from Polaromonas sp. (strain JS666 / ATCC BAA-500) (see paper)
36% identity, 83% coverage: 41:307/323 of query aligns to 49:313/330 of Q128M1
Sites not aligning to the query:
4mhfA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-glucuronate, space group p21 (see paper)
36% identity, 83% coverage: 41:307/323 of query aligns to 19:283/301 of 4mhfA
Sites not aligning to the query:
4mijA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21 (see paper)
36% identity, 83% coverage: 41:307/323 of query aligns to 19:283/302 of 4mijA
Sites not aligning to the query:
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
33% identity, 81% coverage: 45:307/323 of query aligns to 25:287/304 of 4x8rA
Sites not aligning to the query:
4p3lA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound glucuronate, spg p6122 (see paper)
32% identity, 83% coverage: 39:307/323 of query aligns to 16:284/303 of 4p3lA
Sites not aligning to the query:
4ovqA Crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans, target efi-510230, with bound beta-d- glucuronate (see paper)
36% identity, 83% coverage: 40:308/323 of query aligns to 17:286/302 of 4ovqA
Sites not aligning to the query:
4pf8A Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. Nas-14.1 (target efi-510299) with bound beta-d- galacturonate (see paper)
32% identity, 83% coverage: 41:307/323 of query aligns to 17:283/300 of 4pf8A
Sites not aligning to the query:
4x04A Crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899, target efi-510094) with bound d- glucuronate
30% identity, 88% coverage: 40:323/323 of query aligns to 18:301/301 of 4x04A
Sites not aligning to the query:
>Ac3H11_161 FitnessBrowser__acidovorax_3H11:Ac3H11_161
MQLTRLVVGLSLALGFVATAAAQTTMRISISTAQNSHQGIAIDTFAKEVEKRTSGRYKVQ
TFYNGALGGERESIEAVQLGTQELAFSSTGPIPNFVPETKILDVPFLFRDKAHARAVLDG
PIGQEMLTKFDSKGFKALAWAENGFRHMTNSKRSVNTPEDLKGLKMRTMENPVHIAAYKG
FGIITTPMAFPEVFTALQQGTVDGQENPLPVIISAKFDQVQKHLTLTGHVYSPAIFVMNK
GSFDKLSAADKQAFIDAAKEGTKANRARVDEDDAKGVADLRAKGMTVVDNPDKSKFVAAL
APVNAEFEKQFGKATLDKIRDVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory