SitesBLAST
Comparing Ac3H11_1623 FitnessBrowser__acidovorax_3H11:Ac3H11_1623 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5zbmB Structure of glycolate oxidase containing fmn from nicotiana benthamiana (see paper)
39% identity, 96% coverage: 6:381/390 of query aligns to 1:346/353 of 5zbmB
- active site: Y128 (= Y134), D156 (= D162), H248 (= H280)
- binding flavin mononucleotide: Y23 (= Y28), Y24 (≠ A29), P76 (= P81), T77 (= T82), W107 (≠ M112), Q126 (= Q132), Y128 (= Y134), T154 (= T160), K224 (= K256), H248 (= H280), G249 (= G281), R251 (= R283), D279 (= D314), G280 (= G315), R283 (= R318), G302 (= G337), R303 (= R338)
6gmcA 1.2 a resolution structure of human hydroxyacid oxidase 1 bound with fmn and 4-carboxy-5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole
34% identity, 97% coverage: 4:383/390 of query aligns to 2:358/360 of 6gmcA
- active site: Y132 (= Y134), D160 (= D162), H258 (= H280)
- binding 5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole-4-carboxylate: Y26 (= Y28), M82 (≠ L84), W110 (≠ M112), Y132 (= Y134), R167 (= R169), F191 (≠ T193), L203 (= L225), Y206 (≠ W228), H258 (= H280), R261 (= R283)
- binding flavin mononucleotide: Y26 (= Y28), Y27 (≠ A29), A79 (≠ P81), T80 (= T82), A81 (≠ G83), S108 (= S110), Q130 (= Q132), Y132 (= Y134), T158 (= T160), K234 (= K256), H258 (= H280), G259 (= G281), R261 (= R283), D289 (= D314), G290 (= G315), R293 (= R318), G312 (= G337), R313 (= R338)
P05414 Glycolate oxidase; GAO; GOX; Short chain alpha-hydroxy acid oxidase; EC 1.1.3.15 from Spinacia oleracea (Spinach) (see 4 papers)
40% identity, 96% coverage: 6:381/390 of query aligns to 2:352/369 of P05414
- Y24 (= Y28) mutation to F: 10-fold decrease in affinity for glycolate.
- PTA 77:79 (≠ PTG 81:83) binding
- S106 (= S110) binding
- W108 (≠ M112) mutation to S: 100-fold decrease in affinity for glycolate and 500-fold decrease in activity.
- QLY 127:129 (≠ QVY 132:134) binding
- T155 (= T160) binding
- K230 (= K256) binding
- S252 (= S278) binding
- DGGVR 285:289 (≠ DGGIR 314:318) binding
- GR 308:309 (= GR 337:338) binding
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
Q9UJM8 2-Hydroxyacid oxidase 1; HAOX1; Glycolate oxidase; GO; GOX; Glyoxylate oxidase; EC 1.1.3.15; EC 1.2.3.5 from Homo sapiens (Human) (see 2 papers)
34% identity, 97% coverage: 4:383/390 of query aligns to 2:360/370 of Q9UJM8
6gmbA Structure of human hydroxyacid oxidase 1 bound with fmn and glycolate
34% identity, 97% coverage: 4:383/390 of query aligns to 2:360/362 of 6gmbA
- active site: Y132 (= Y134), D160 (= D162), H260 (= H280)
- binding flavin mononucleotide: Y26 (= Y28), Y27 (≠ A29), A79 (≠ P81), T80 (= T82), A81 (≠ G83), S108 (= S110), Q130 (= Q132), Y132 (= Y134), K236 (= K256), H260 (= H280), G261 (= G281), R263 (= R283), D291 (= D314), G292 (= G315), G293 (= G316), R295 (= R318), G314 (= G337), R315 (= R338)
- binding glycolic acid: Y26 (= Y28), W110 (≠ M112), Y132 (= Y134), R167 (= R169), H260 (= H280), R263 (= R283)
1al7A Three-dimensional structures of glycolate oxidase with bound active- site inhibitors (see paper)
40% identity, 96% coverage: 6:381/390 of query aligns to 2:343/350 of 1al7A
- active site: S106 (= S110), Y129 (= Y134), T155 (= T160), D157 (= D162), K221 (= K256), H245 (= H280)
- binding flavin mononucleotide: Y24 (= Y28), Y25 (≠ A29), P77 (= P81), T78 (= T82), A79 (≠ G83), S106 (= S110), Q127 (= Q132), T155 (= T160), K221 (= K256), H245 (= H280), R248 (= R283), D276 (= D314), G277 (= G315), R280 (= R318), G299 (= G337), R300 (= R338)
- binding 4-carboxy-5-(1-pentyl)hexylsulfanyl-1,2,3-triazole: Y24 (= Y28), W108 (≠ M112), Y129 (= Y134), R164 (= R169), F172 (≠ L177), I198 (≠ F233), H245 (= H280), R248 (= R283)
2rduA Crystal structure of human glycolate oxidase in complex with glyoxylate (see paper)
34% identity, 97% coverage: 6:383/390 of query aligns to 2:358/360 of 2rduA
- active site: S106 (= S110), Y130 (= Y134), T156 (= T160), D158 (= D162), K234 (= K256), H258 (= H280)
- binding flavin mononucleotide: Y24 (= Y28), Y25 (≠ A29), A77 (≠ P81), T78 (= T82), A79 (≠ G83), S106 (= S110), Q128 (= Q132), Y130 (= Y134), T156 (= T160), K234 (= K256), H258 (= H280), G259 (= G281), R261 (= R283), D289 (= D314), G290 (= G315), G291 (= G316), R293 (= R318), G312 (= G337), R313 (= R338)
- binding glyoxylic acid: Y24 (= Y28), W108 (≠ M112), Y130 (= Y134), R165 (= R169), H258 (= H280), R261 (= R283)
5qigA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1407672867
34% identity, 97% coverage: 6:383/390 of query aligns to 1:357/359 of 5qigA
- active site: Y129 (= Y134), D157 (= D162), H257 (= H280)
- binding flavin mononucleotide: Y23 (= Y28), Y24 (≠ A29), A76 (≠ P81), T77 (= T82), A78 (≠ G83), S105 (= S110), Q127 (= Q132), Y129 (= Y134), T155 (= T160), K233 (= K256), H257 (= H280), G258 (= G281), R260 (= R283), D288 (= D314), G289 (= G315), G290 (= G316), R292 (= R318), G311 (= G337), R312 (= R338)
- binding 2-cyclopropyl-1~{H}-imidazole-4-carboxamide: L2 (≠ I7), R223 (≠ K246), G248 (= G271), F320 (≠ A346), K324 (≠ A350), D328 (≠ R354)
5qifA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z31792168
34% identity, 97% coverage: 6:383/390 of query aligns to 1:357/359 of 5qifA
- active site: Y129 (= Y134), D157 (= D162), H257 (= H280)
- binding flavin mononucleotide: Y23 (= Y28), Y24 (≠ A29), A76 (≠ P81), T77 (= T82), A78 (≠ G83), S105 (= S110), Q127 (= Q132), Y129 (= Y134), K233 (= K256), H257 (= H280), G258 (= G281), R260 (= R283), D288 (= D314), G289 (= G315), R292 (= R318), G311 (= G337), R312 (= R338)
- binding 2-cyclohexyl-~{N}-pyridin-3-yl-ethanamide: R223 (≠ K246), R224 (≠ K247), S227 (≠ G250)
2rdwA Crystal structure of human glycolate oxidase in complex with sulfate (see paper)
34% identity, 97% coverage: 6:383/390 of query aligns to 1:357/359 of 2rdwA
- active site: S105 (= S110), Y129 (= Y134), T155 (= T160), D157 (= D162), K233 (= K256), H257 (= H280)
- binding flavin mononucleotide: Y23 (= Y28), Y24 (≠ A29), A76 (≠ P81), T77 (= T82), A78 (≠ G83), Q127 (= Q132), Y129 (= Y134), T155 (= T160), K233 (= K256), H257 (= H280), G258 (= G281), R260 (= R283), D288 (= D314), G289 (= G315), R292 (= R318), G311 (= G337), R312 (= R338)
- binding sulfate ion: Y23 (= Y28), W107 (≠ M112), R164 (= R169), H257 (= H280), R260 (= R283)
7r4nA Structure of human hydroxyacid oxidase 1 bound with 5-bromo-n-methyl- 1h-indazole-3-carboxamide
34% identity, 97% coverage: 4:383/390 of query aligns to 1:350/352 of 7r4nA
- binding 5-bromanyl-N-methyl-1H-indazole-3-carboxamide: Y25 (= Y28), A80 (≠ G83), M81 (≠ L84), W109 (≠ M112), Y131 (= Y134), R166 (= R169), M182 (≠ I185), H250 (= H280), R253 (= R283)
- binding flavin mononucleotide: Y25 (= Y28), Y26 (≠ A29), A78 (≠ P81), T79 (= T82), A80 (≠ G83), S107 (= S110), W109 (≠ M112), Q129 (= Q132), Y131 (= Y134), T157 (= T160), K226 (= K256), H250 (= H280), G251 (= G281), R253 (= R283), D281 (= D314), G282 (= G315), R285 (= R318), G304 (= G337), R305 (= R338)
5qieA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2856434894
34% identity, 97% coverage: 6:383/390 of query aligns to 1:351/353 of 5qieA
- active site: Y129 (= Y134), D157 (= D162), H251 (= H280)
- binding flavin mononucleotide: Y23 (= Y28), Y24 (≠ A29), A76 (≠ P81), T77 (= T82), A78 (≠ G83), S105 (= S110), Q127 (= Q132), Y129 (= Y134), K227 (= K256), H251 (= H280), G252 (= G281), R254 (= R283), D282 (= D314), G283 (= G315), R286 (= R318), G305 (= G337), R306 (= R338)
- binding ~{N},~{N}-dimethyl-4-[(propan-2-ylamino)methyl]aniline: I3 (≠ T8), D322 (≠ R354)
Q8Z0C8 L-lactate oxidase; LOX; Glyoxylate oxidase; No-LOX; EC 1.1.3.-; EC 1.2.3.5 from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
40% identity, 94% coverage: 16:383/390 of query aligns to 16:363/365 of Q8Z0C8
- M82 (≠ T82) mutation to T: Increases oxidation activity with both L-lactate and glycolate. Shows a 6-fold decrease in the L-lactate/glycolate oxidase activity ratio.
- L112 (≠ M112) mutation to W: Impairs oxidation of L-lactate. Shows a 2-fold decrease in the L-lactate/glycolate oxidase activity ratio.
- F212 (≠ T229) mutation to V: Impairs oxidation of L-lactate. Shows a 27-fold decrease in the L-lactate/glycolate oxidase activity ratio.
5qihA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2697514548
33% identity, 97% coverage: 6:383/390 of query aligns to 1:342/344 of 5qihA
- active site: Y129 (= Y134), D157 (= D162), H242 (= H280)
- binding flavin mononucleotide: Y23 (= Y28), Y24 (≠ A29), A76 (≠ P81), T77 (= T82), A78 (≠ G83), S105 (= S110), Q127 (= Q132), Y129 (= Y134), K218 (= K256), H242 (= H280), G243 (= G281), R245 (= R283), D273 (= D314), G274 (= G315), R277 (= R318), G296 (= G337), R297 (= R338)
- binding 1-methylindazole-3-carboxamide: Y23 (= Y28), A78 (≠ G83), M79 (≠ L84), W107 (≠ M112), Y129 (= Y134), M180 (≠ I185), L187 (= L225), H242 (= H280)
5qidA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1787627869
33% identity, 97% coverage: 6:383/390 of query aligns to 1:342/344 of 5qidA
- active site: Y129 (= Y134), D157 (= D162), H242 (= H280)
- binding flavin mononucleotide: Y23 (= Y28), Y24 (≠ A29), A76 (≠ P81), T77 (= T82), A78 (≠ G83), S105 (= S110), Q127 (= Q132), Y129 (= Y134), K218 (= K256), H242 (= H280), G243 (= G281), R245 (= R283), D273 (= D314), G274 (= G315), R277 (= R318), G296 (= G337), R297 (= R338)
- binding 5-chloranyl-~{N}-methyl-~{N}-[[(3~{S})-oxolan-3-yl]methyl]pyrimidin-4-amine: T57 (≠ R62), E320 (≠ K361), R323 (≠ D364)
5qicA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z30620520
33% identity, 97% coverage: 6:383/390 of query aligns to 1:342/344 of 5qicA
- active site: Y129 (= Y134), D157 (= D162), H242 (= H280)
- binding flavin mononucleotide: Y23 (= Y28), Y24 (≠ A29), A76 (≠ P81), T77 (= T82), A78 (≠ G83), S105 (= S110), Q127 (= Q132), Y129 (= Y134), K218 (= K256), H242 (= H280), G243 (= G281), R245 (= R283), D273 (= D314), G274 (= G315), R277 (= R318), G296 (= G337), R297 (= R338)
- binding cyclopropyl-[4-(4-fluorophenyl)piperazin-1-yl]methanone: Y131 (≠ M136), K132 (≠ R137), V136 (≠ F141), M180 (≠ I185), F183 (≠ L188), Y190 (≠ W228), K193 (≠ E231), A194 (≠ Q232)
5qibA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with fmopl000388a
33% identity, 97% coverage: 6:383/390 of query aligns to 1:342/344 of 5qibA
- active site: Y129 (= Y134), D157 (= D162), H242 (= H280)
- binding 1-deoxy-1-(7,8-dimethyl-2,4-dioxo-3,4-dihydro-2h-benzo[g]pteridin-1-id-10(5h)-yl)-5-o-phosphonato-d-ribitol: Y23 (= Y28), Y24 (≠ A29), A76 (≠ P81), T77 (= T82), A78 (≠ G83), S105 (= S110), Q127 (= Q132), Y129 (= Y134), K218 (= K256), H242 (= H280), G243 (= G281), R245 (= R283), D273 (= D314), G274 (= G315), G275 (= G316), R277 (= R318), G296 (= G337), R297 (= R338)
- binding 5-(cyclohexylamino)pyrimidine-2,4(1H,3H)-dione: Y23 (= Y28), M79 (≠ L84), W107 (≠ M112), Y129 (= Y134), R164 (= R169), M180 (≠ I185), L187 (= L225), H242 (= H280), R245 (= R283)
7r4oA Structure of human hydroxyacid oxidase 1 bound with 2-((4h-1,2,4- triazol-3-yl)thio)-1-(4-(3-chlorophenyl)piperazin-1-yl)ethan-1-one
33% identity, 97% coverage: 6:383/390 of query aligns to 2:339/341 of 7r4oA
- binding flavin mononucleotide: Y25 (≠ A29), A77 (≠ P81), T78 (= T82), A79 (≠ G83), S106 (= S110), Q128 (= Q132), Y130 (= Y134), K215 (= K256), H239 (= H280), G240 (= G281), R242 (= R283), D270 (= D314), G271 (= G315), R274 (= R318), G293 (= G337), R294 (= R338)
- binding 2-((4H-1,2,4-triazol-3-yl)thio)-1-(4-(3-chlorophenyl)piperazin-1-yl)ethan-1-one: Y132 (≠ M136), K133 (≠ R137), D134 (= D138), N183 (= N187), K190 (≠ E231)
1al8A Three-dimensional structure of glycolate oxidase with bound active- site inhibitors (see paper)
39% identity, 96% coverage: 6:381/390 of query aligns to 2:337/344 of 1al8A
- active site: S106 (= S110), Y129 (= Y134), T155 (= T160), D157 (= D162), K215 (= K256), H239 (= H280)
- binding 3-decyl-2,5-dioxo-4-hydroxy-3-pyrroline: Y24 (= Y28), W108 (≠ M112), Y129 (= Y134), F166 (≠ L177), H239 (= H280), R242 (= R283)
- binding flavin mononucleotide: Y25 (≠ A29), P77 (= P81), T78 (= T82), A79 (≠ G83), S106 (= S110), Q127 (= Q132), Y129 (= Y134), T155 (= T160), K215 (= K256), H239 (= H280), R242 (= R283), D270 (= D314), G271 (= G315), R274 (= R318), G293 (= G337), R294 (= R338)
7r4pA Structure of human hydroxyacid oxidase 1 bound with 6-amino-1-benzyl- 5-(methylamino)pyrimidine-2,4(1h,3h)-dione
32% identity, 97% coverage: 6:383/390 of query aligns to 2:335/337 of 7r4pA
- binding flavin mononucleotide: Y25 (≠ A29), A77 (≠ P81), T78 (= T82), A79 (≠ G83), S106 (= S110), Q128 (= Q132), Y130 (= Y134), T156 (= T160), K211 (= K256), H235 (= H280), G236 (= G281), R238 (= R283), D266 (= D314), G267 (= G315), R270 (= R318), G289 (= G337), R290 (= R338)
- binding 6-amino-1-benzyl-5-(methylamino)pyrimidine-2,4(1H,3H)-dione: Y24 (= Y28), A79 (≠ G83), M80 (≠ L84), W108 (≠ M112), Y130 (= Y134), R165 (= R169), L180 (= L225), H235 (= H280), R238 (= R283)
Query Sequence
>Ac3H11_1623 FitnessBrowser__acidovorax_3H11:Ac3H11_1623
VPDLSKITCIEDLRAIAQRRVPRMFYDYADSGSYTEGTYRANESDFQRIKLRQRVAVNME
GRSTRTTMVGQDVAMPVAIAPTGLTGMQHADGEILGAKAAKAFGIPFTLSTMSICSIEDI
AEHTGRHPFWFQVYVMRDRDFIERLIDRAKAANCSALQLTLDLQILGQRHKDIKNGLSAP
PKPTIANLINLATKPRWCLGMLGTKRRSFGNIVGHAKGVGDLSSLSSWTAEQFDPQLNWG
DVEWIKKRWGGKLILKGIMDAEDARLAVNSGADALIVSNHGGRQLDGAPSSIAALPGIAD
AVAQMGGGIEVWMDGGIRSGQDVLKARALGAQGTLIGRSFLYGLGAYGEAGVTRALQIIQ
KELDITMAFCGHTNINTVDRSILLPGTYPV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory