Comparing Ac3H11_1642 FitnessBrowser__acidovorax_3H11:Ac3H11_1642 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
50% identity, 91% coverage: 26:293/296 of query aligns to 8:275/278 of 2ia4B
2vhaA Debp (see paper)
50% identity, 91% coverage: 26:293/296 of query aligns to 7:274/276 of 2vhaA
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
50% identity, 83% coverage: 23:268/296 of query aligns to 2:247/503 of 8ovoA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
35% identity, 70% coverage: 58:264/296 of query aligns to 38:234/243 of 5eyfB
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
29% identity, 74% coverage: 46:264/296 of query aligns to 16:225/226 of 4zv1A
Sites not aligning to the query:
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
28% identity, 74% coverage: 46:264/296 of query aligns to 16:223/225 of 4zv2A
Sites not aligning to the query:
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
28% identity, 81% coverage: 26:264/296 of query aligns to 2:228/229 of 5t0wA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
30% identity, 74% coverage: 46:264/296 of query aligns to 22:227/229 of 6svfA
Sites not aligning to the query:
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
28% identity, 78% coverage: 35:264/296 of query aligns to 4:221/226 of 8eyzA
4ohnA Crystal structure of an abc uptake transporter substrate binding protein from streptococcus pneumoniae with bound histidine
22% identity, 84% coverage: 22:271/296 of query aligns to 1:246/246 of 4ohnA
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
24% identity, 70% coverage: 58:263/296 of query aligns to 35:229/231 of 2v25A
Sites not aligning to the query:
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
25% identity, 72% coverage: 58:270/296 of query aligns to 77:282/288 of 6h2tA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
25% identity, 72% coverage: 58:270/296 of query aligns to 76:281/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
25% identity, 72% coverage: 58:270/296 of query aligns to 76:281/287 of 6h1uA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
24% identity, 78% coverage: 34:265/296 of query aligns to 4:227/234 of 3k4uE
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
25% identity, 74% coverage: 46:264/296 of query aligns to 13:222/224 of 4ymxA
Sites not aligning to the query:
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
26% identity, 81% coverage: 24:262/296 of query aligns to 1:229/247 of 2yjpA
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
23% identity, 79% coverage: 24:256/296 of query aligns to 5:237/324 of 4z9nB
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
22% identity, 82% coverage: 27:268/296 of query aligns to 1:235/237 of 4i62A
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
26% identity, 78% coverage: 32:263/296 of query aligns to 12:233/235 of 4g4pA
>Ac3H11_1642 FitnessBrowser__acidovorax_3H11:Ac3H11_1642
MKLSAVTSAAIVVTGLLASTVVSADTLKKVAESGKITLAYRESSVPFSYLSGPGVPVGFA
VDISNAVVDAVKKRVNNPALKVELQAVTSQNRIPLLTNGTIDLECGSTTNNSVRGKDVQF
AVNYFYTGTRLLTKKTSGVKNYADLAKKKVASTSGTTNAQVIRKYNRDQNLDMDIVLGKD
HDDSLLLVESGRAEAFAMDDILLFGLMGNQRNPAEWTVVGDSLQVEPYACMLRKDDPQFQ
ALVNGVIGGMMKSGEFDKLYTKWFMSPVPPRNQNLNLAMSKELRENLVAQSDKPAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory