SitesBLAST
Comparing Ac3H11_1644 FitnessBrowser__acidovorax_3H11:Ac3H11_1644 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P40875 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 3 papers)
26% identity, 69% coverage: 125:402/405 of query aligns to 94:373/405 of P40875
- C146 (≠ E175) mutation to S: No change in activity.
- H173 (≠ C199) modified: Tele-8alpha-FMN histidine; mutation to N: Prevents covalent attachment of FMN. Loss of activity. The mutant is considerably less stable than wild-type enzyme, the beta and delta subunits are lost during purification, which yields a stable alpha-gamma complex.
- H175 (≠ A201) mutation to A: No effect on FMN binding and activity.
- C195 (≠ A221) mutation to S: No change in activity.
- C351 (≠ T380) mutation to A: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 30 G→A: Prevents covalent attachment of FMN. Blocks subunit assembly.
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
25% identity, 70% coverage: 118:402/405 of query aligns to 87:371/403 of 2gagB
- binding flavin-adenine dinucleotide: V195 (≠ I223), G224 (≠ L252), A225 (≠ G253), H227 (≠ A255), L231 (≠ A259), L246 (= L272), G352 (= G383), T353 (≠ A384), G354 (≠ L385), G355 (= G386), F356 (= F387), K357 (≠ T388)
- binding flavin mononucleotide: H171 (≠ C199), V250 (≠ S276), E278 (≠ Q307), R321 (= R350), W323 (= W352)
- binding 2-furoic acid: M263 (≠ V293), Y270 (≠ V300), K357 (≠ T388)
- binding sulfite ion: K170 (≠ D198), K276 (≠ I305)
Sites not aligning to the query:
- active site: 61, 64, 65
- binding flavin-adenine dinucleotide: 26, 28, 29, 30, 51, 52, 58, 59, 60, 62, 63, 64, 66
- binding flavin mononucleotide: 61, 62
- binding 2-furoic acid: 64, 66, 68, 401
1vrqB Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
25% identity, 68% coverage: 128:402/405 of query aligns to 98:372/402 of 1vrqB
- active site: G326 (= G354), K358 (≠ T388)
- binding n,n-dimethylglycine: K358 (≠ T388)
- binding flavin-adenine dinucleotide: V196 (≠ I223), A224 (= A251), G225 (≠ L252), H228 (≠ A255), L247 (= L272), G353 (= G383), T354 (≠ A384), G355 (≠ L385), G356 (= G386), F357 (= F387), K358 (≠ T388)
- binding flavin mononucleotide: H172 (≠ C199), V251 (≠ S276), E279 (≠ Q307), R322 (= R350), W324 (= W352)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding n,n-dimethylglycine: 65, 67, 69, 401
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 51, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
3ad8B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with pyrrole 2-carboxylate (see paper)
25% identity, 68% coverage: 128:402/405 of query aligns to 98:372/404 of 3ad8B
- active site: G326 (= G354), K358 (≠ T388)
- binding flavin-adenine dinucleotide: V196 (≠ I223), G225 (≠ L252), A226 (≠ G253), H228 (≠ A255), L247 (= L272), G353 (= G383), T354 (≠ A384), G355 (≠ L385), G356 (= G386), F357 (= F387), K358 (≠ T388)
- binding flavin mononucleotide: H172 (≠ C199), V251 (≠ S276), E279 (≠ Q307), R322 (= R350), W324 (= W352)
- binding pyrrole-2-carboxylate: M264 (≠ V293), Y271 (≠ V300), T354 (≠ A384), K358 (≠ T388)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
- binding pyrrole-2-carboxylate: 65, 67, 69, 402
3ad7B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
25% identity, 68% coverage: 128:402/405 of query aligns to 98:372/404 of 3ad7B
- active site: G326 (= G354), K358 (≠ T388)
- binding flavin-adenine dinucleotide: V196 (≠ I223), G225 (≠ L252), A226 (≠ G253), H228 (≠ A255), L247 (= L272), G353 (= G383), T354 (≠ A384), G355 (≠ L385), G356 (= G386), F357 (= F387), K358 (≠ T388)
- binding flavin mononucleotide: H172 (≠ C199), V251 (≠ S276), K277 (≠ I305), E279 (≠ Q307), R322 (= R350), W324 (= W352)
- binding [methylthio]acetate: M264 (≠ V293), Y271 (≠ V300), T354 (≠ A384), K358 (≠ T388)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
- binding [methylthio]acetate: 67, 69, 402
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
23% identity, 91% coverage: 2:368/405 of query aligns to 6:347/830 of Q9AGP8
- IV 14:15 (= IV 10:11) binding FAD
- DQ 35:36 (= DQ 30:31) binding FAD
- STSH 45:48 (≠ GASG 37:40) binding FAD
- L52 (= L67) binding FAD
- V174 (≠ I223) binding FAD
- H225 (≠ G274) Important for catalytic activity; mutation to Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- Y259 (≠ V301) Important for catalytic activity; binding FAD; mutation to F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
Sites not aligning to the query:
- 360:363 binding FAD
- 539 binding (6S)-5,6,7,8-tetrahydrofolate
- 552 Important for catalytic activity; D→A: No effect on the activity.; D→N: Reduces activity 3-fold.
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
23% identity, 91% coverage: 2:368/405 of query aligns to 3:344/827 of 1pj7A
- active site: H222 (≠ G274), Y256 (≠ V301)
- binding flavin-adenine dinucleotide: G8 (= G7), G10 (= G9), I11 (= I10), V12 (= V11), D32 (= D30), Q33 (= Q31), G41 (≠ T36), S42 (≠ G37), T43 (≠ A38), H45 (≠ G40), P47 (≠ N42), L49 (= L67), T170 (≠ R222), V171 (≠ I223), A200 (≠ L252), G201 (= G253), W203 (≠ A255), H222 (≠ G274), Y256 (≠ V301), I331 (≠ M355)
Sites not aligning to the query:
- active site: 549
- binding flavin-adenine dinucleotide: 357, 358, 359, 360
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: 505, 536, 549, 551, 563, 629, 648, 655, 696
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
23% identity, 91% coverage: 2:368/405 of query aligns to 4:345/828 of 1pj6A
- active site: H223 (≠ G274), Y257 (≠ V301)
- binding flavin-adenine dinucleotide: G9 (= G7), G11 (= G9), I12 (= I10), V13 (= V11), D33 (= D30), Q34 (= Q31), G42 (≠ T36), S43 (≠ G37), T44 (≠ A38), H46 (≠ G40), P48 (≠ N42), L50 (= L67), V172 (≠ I223), A201 (≠ L252), G202 (= G253), W204 (≠ A255), H223 (≠ G274), Y257 (≠ V301), G331 (= G354), I332 (≠ M355)
Sites not aligning to the query:
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
23% identity, 91% coverage: 2:368/405 of query aligns to 3:344/827 of 3gsiA
- active site: H222 (≠ G274), Y256 (≠ V301)
- binding flavin-adenine dinucleotide: G10 (= G9), I11 (= I10), V12 (= V11), D32 (= D30), Q33 (= Q31), G41 (≠ T36), S42 (≠ G37), T43 (≠ A38), H45 (≠ G40), P47 (≠ N42), L49 (= L67), T170 (≠ R222), V171 (≠ I223), A200 (≠ L252), G201 (= G253), W203 (≠ A255), H222 (≠ G274), Y256 (≠ V301), G330 (= G354), I331 (≠ M355), F332 (≠ R356)
- binding magnesium ion: D254 (≠ K299)
Sites not aligning to the query:
- active site: 549
- binding flavin-adenine dinucleotide: 357, 358, 359, 360
- binding magnesium ion: 409
- binding (6s)-5,6,7,8-tetrahydrofolate: 505, 536, 551, 563, 629, 648, 655, 696
Q50LF2 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 4 papers)
25% identity, 68% coverage: 128:402/405 of query aligns to 99:373/405 of Q50LF2
- K172 (≠ D198) mutation to A: Retains 39% of wild-type activity.; mutation to D: Retains 32% of wild-type activity.; mutation to R: Retains 58% of wild-type activity.
- H173 (≠ C199) modified: Tele-8alpha-FMN histidine
- V197 (≠ I223) binding FAD
- H270 (≠ R298) mutation to A: 10-fold decrease in catalytic efficiency.
- Y272 (≠ V300) mutation to A: 13000-fold decrease in catalytic efficiency.; mutation to F: 130-fold decrease in catalytic efficiency.
- G354 (= G383) binding FAD
- G357 (= G386) binding FAD
- K359 (≠ T388) binding FAD; mutation K->A,D: Loss of activity.; mutation to R: Retains 0.07% of wild-type activity. Shows higher apparent KM for sarcosine.
Sites not aligning to the query:
- 31 binding FAD
- 32 binding FAD
- 53 binding FAD
- 61 binding FAD
- 62 binding FAD
- 66 binding FAD
- 68 binding FAD
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
21% identity, 69% coverage: 122:402/405 of query aligns to 72:352/374 of 1y56B
- active site: H224 (≠ G274), P239 (= P289), G305 (= G354), M338 (≠ T388)
- binding flavin-adenine dinucleotide: E170 (≠ R222), V171 (≠ I223), T200 (≠ L252), N201 (≠ G253), W203 (≠ A255), G305 (= G354), Y306 (≠ M355), Y307 (≠ R356), G334 (≠ A384), H335 (≠ L385), G336 (= G386), F337 (= F387), M338 (≠ T388)
- binding flavin mononucleotide: I260 (≠ M314), R301 (= R350), W303 (= W352)
Sites not aligning to the query:
- active site: 44, 47, 48
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 33, 34, 35, 42, 43, 45, 46, 47, 49
- binding flavin mononucleotide: 44, 45
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
25% identity, 58% coverage: 167:401/405 of query aligns to 121:346/369 of O31616
- V174 (vs. gap) binding FAD
- H244 (≠ R298) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R356) binding substrate
- 327:333 (vs. 382:388, 29% identical) binding FAD
- R329 (≠ A384) binding substrate
Sites not aligning to the query:
- 14:15 binding FAD
- 34:35 binding FAD
- 42:43 binding FAD
- 47:49 binding FAD
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
25% identity, 58% coverage: 167:401/405 of query aligns to 121:346/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (vs. gap), V174 (vs. gap), S202 (≠ L252), G203 (= G253), W205 (≠ A255), F209 (≠ A259), G300 (= G354), R302 (= R356), H327 (= H382), F328 (≠ G383), R329 (≠ A384), N330 (≠ L385), G331 (= G386), I332 (≠ F387)
- binding glycolic acid: Y246 (≠ V300), R302 (= R356), R329 (≠ A384)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
25% identity, 58% coverage: 167:401/405 of query aligns to 121:346/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ V300), R302 (= R356), R329 (≠ A384)
- binding flavin-adenine dinucleotide: V174 (vs. gap), S202 (≠ L252), G203 (= G253), W205 (≠ A255), F209 (≠ A259), G300 (= G354), R302 (= R356), H327 (= H382), R329 (≠ A384), N330 (≠ L385), G331 (= G386), I332 (≠ F387)
- binding phosphate ion: R254 (= R308)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
- binding phosphate ion: 89
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
27% identity, 51% coverage: 194:401/405 of query aligns to 149:346/369 of S5FMM4
- S202 (≠ L252) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ F387) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ V397) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
23% identity, 70% coverage: 119:401/405 of query aligns to 77:351/370 of 4yshA
- active site: I262 (≠ V311), L283 (= L332), G305 (= G354), N335 (≠ L385), L338 (≠ T388)
- binding flavin-adenine dinucleotide: V178 (≠ G225), S206 (≠ L252), G207 (= G253), W209 (≠ A255), R307 (= R356), H332 (= H382), R334 (≠ A384), N335 (≠ L385), G336 (= G386), I337 (≠ F387)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
23% identity, 70% coverage: 119:401/405 of query aligns to 77:351/368 of 4yshB
- active site: I262 (≠ V311), L283 (= L332), G305 (= G354), N335 (≠ L385), L338 (≠ T388)
- binding flavin-adenine dinucleotide: V178 (≠ G225), S206 (≠ L252), W209 (≠ A255), R307 (= R356), H332 (= H382), R334 (≠ A384), N335 (≠ L385), G336 (= G386), I337 (≠ F387), L338 (≠ T388)
- binding glycine: G249 (vs. gap), Y251 (≠ V300), Y251 (≠ V300), A264 (≠ G313), R307 (= R356), R334 (≠ A384), R334 (≠ A384)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
23% identity, 70% coverage: 119:401/405 of query aligns to 78:353/377 of Q5L2C2
- V180 (≠ G225) binding FAD
- R309 (= R356) binding substrate
- 334:340 (vs. 382:388, 29% identical) binding FAD
- R336 (≠ A384) binding substrate
Sites not aligning to the query:
- 14:15 binding FAD
- 34:35 binding FAD
- 42:43 binding FAD
- 47:49 binding FAD
6pxsA Crystal structure of iminodiacetate oxidase (idaa) from chelativorans sp. Bnc1 (see paper)
22% identity, 96% coverage: 1:389/405 of query aligns to 1:339/370 of 6pxsA
- binding flavin-adenine dinucleotide: G7 (= G7), G9 (= G9), I10 (= I10), D30 (= D30), N32 (≠ A32), H33 (≠ Q33), K36 (≠ T36), A37 (≠ G37), T38 (≠ A38), A40 (≠ G40), G41 (= G41), A42 (≠ N42), G43 (= G43), V44 (≠ L67), Y174 (≠ G225), A203 (≠ L252), W206 (≠ A255), I210 (≠ A259), Y250 (≠ R298), G305 (= G354), R307 (= R356), G333 (= G383), A334 (= A384), S335 (≠ L385), G336 (= G386), L337 (≠ F387), T338 (= T388)
6j39A Crystal structure of cmis2 with inhibitor (see paper)
23% identity, 97% coverage: 11:401/405 of query aligns to 11:351/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: M44 (≠ Q45), P46 (= P53), N49 (= N56), R243 (vs. gap), Y252 (≠ V300), Y267 (≠ A315), R308 (= R356), R334 (≠ A384), I335 (≠ L385)
- binding flavin-adenine dinucleotide: I11 (≠ V11), V29 (≠ I29), D30 (= D30), P31 (≠ Q31), E32 (≠ Q33), K36 (≠ G37), A37 (= A38), S38 (= S39), V40 (≠ G41), S41 (≠ N42), A42 (≠ G43), G43 (≠ A44), M44 (≠ Q45), A174 (= A230), A203 (≠ L252), W206 (≠ A255), I228 (≠ S276), Y252 (≠ V300), R308 (= R356), S333 (≠ G383), R334 (≠ A384), I335 (≠ L385), G336 (= G386), V337 (≠ F387), Q338 (≠ T388)
Sites not aligning to the query:
Query Sequence
>Ac3H11_1644 FitnessBrowser__acidovorax_3H11:Ac3H11_1644
MQVCVLGAGIVGLATAYELHQRGMQVTVIDQAQPGTGASGGNGAQLSYSYVQPLANADLW
QQLPELLLSPRSPLKMRPQWDVHQWRWGLEFLRACNRRTSERSTEQLLALATLSRHGFEA
MRQAEQLDCDFSSTGKLVLYSTPAGLAAAQRQMELQRAWGSEQESVSPQRCVEIEPALQH
YQSHIAGAIHTPSECAADCLAVCQGLHRILAARGVHFVLGARIEGFVRRAQRIAAVQTSA
GAIEAQQFVLALGSASHQAAQTLGFRLPVYPLKGYSITLDTTDAANAAPRVNVTDAARKV
VFARIGQRLRVAGMAELVGHNHHIPPARIQSLREATRALFPGCSDFGELRPWTGMRPATP
TGVPLVGRHPHAPDNLLLNTGHGALGFTLAFGTAAQVAELVAPAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory