Comparing Ac3H11_1664 FitnessBrowser__acidovorax_3H11:Ac3H11_1664 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
39% identity, 93% coverage: 6:278/294 of query aligns to 14:288/296 of 3w6zA
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
39% identity, 93% coverage: 6:278/294 of query aligns to 14:285/293 of 3ws7A
5y8hA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD+ (see paper)
38% identity, 96% coverage: 8:290/294 of query aligns to 3:290/291 of 5y8hA
5y8iA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + (s)-3-hydroxyisobutyrate (s-hiba) (see paper)
38% identity, 96% coverage: 8:290/294 of query aligns to 3:290/292 of 5y8iA
5y8lB Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD +(s)-3-hydroxyisobutyrate (s-hiba) (see paper)
38% identity, 98% coverage: 1:287/294 of query aligns to 1:288/290 of 5y8lB
5y8kA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + l-serine (see paper)
38% identity, 98% coverage: 1:287/294 of query aligns to 1:288/290 of 5y8kA
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
34% identity, 93% coverage: 7:280/294 of query aligns to 3:273/289 of 2cvzC
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
34% identity, 93% coverage: 7:280/294 of query aligns to 2:272/288 of 1wp4A
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
30% identity, 95% coverage: 7:284/294 of query aligns to 3:282/287 of 3pefA
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
26% identity, 97% coverage: 7:290/294 of query aligns to 5:292/294 of 5je8B
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
32% identity, 81% coverage: 11:247/294 of query aligns to 7:245/287 of 3pduA
Sites not aligning to the query:
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
31% identity, 71% coverage: 2:210/294 of query aligns to 37:248/335 of P29266
Q8T079 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60 homolog; Nucleosome-destabilizing factor; Putative oxidoreductase GLYR1 homolog from Drosophila melanogaster (Fruit fly) (see paper)
24% identity, 94% coverage: 11:285/294 of query aligns to 321:598/602 of Q8T079
Sites not aligning to the query:
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
38% identity, 70% coverage: 7:211/294 of query aligns to 2:210/294 of 3q3cA
Sites not aligning to the query:
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
39% identity, 70% coverage: 7:211/294 of query aligns to 3:212/298 of Q9I5I6
Sites not aligning to the query:
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
30% identity, 69% coverage: 8:210/294 of query aligns to 3:210/296 of 2i9pB
Sites not aligning to the query:
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
30% identity, 71% coverage: 2:210/294 of query aligns to 38:249/336 of P31937
Sites not aligning to the query:
3obbA Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 (see paper)
37% identity, 70% coverage: 7:211/294 of query aligns to 3:211/295 of 3obbA
Sites not aligning to the query:
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
28% identity, 95% coverage: 8:287/294 of query aligns to 3:285/295 of 6smzC
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
28% identity, 95% coverage: 8:287/294 of query aligns to 3:285/294 of 6smyA
>Ac3H11_1664 FitnessBrowser__acidovorax_3H11:Ac3H11_1664
MTTTPLRIAVLGIGMMGLPMARRLSEAGHPVRAWNRTRAKAEPLALYGVTVSNTPAEAVQ
DADIVISLLENGPVVGQVLFDQGAARAMRRGSLFIDMASIQPSEARDHAARLGELGVAHL
DAPVSGGTVGAEAGTLAIMVGGRPEDYQRALPVFAPLGRATHVGPHGAGQLAKLANQMIV
GITIGAVAEALLFAAKGGADMAKVREAISGGFADSRILQLHGQRMVERDFAPRGRMAVQL
KDMRNAMATAHETGFDAPITALFEALYADGVEHGLGDLDHSGLFVELASRNAMQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory