SitesBLAST
Comparing Ac3H11_1712 FitnessBrowser__acidovorax_3H11:Ac3H11_1712 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6wy8C Tcur3481-tcur3483 steroid acad (see paper)
29% identity, 97% coverage: 1:361/371 of query aligns to 1:359/364 of 6wy8C
4x28D Crystal structure of the chse4-chse5 complex from mycobacterium tuberculosis (see paper)
26% identity, 99% coverage: 1:366/371 of query aligns to 1:362/364 of 4x28D
6cxtB Crystal structure of fad-dependent dehydrogenase (see paper)
28% identity, 80% coverage: 37:332/371 of query aligns to 24:338/372 of 6cxtB
- active site: I117 (≠ Y123), S118 (≠ Q124), E234 (≠ A229)
- binding flavin-adenine dinucleotide: N115 (≠ L121), I117 (≠ Y123), S118 (≠ Q124), G123 (≠ R129), S124 (≠ Y130), Y148 (≠ I154), T150 (≠ A156), L201 (≠ V202)
- binding S-[2-({N-[(2R)-2-hydroxy-4-{[(R)-hydroxy(oxo)-lambda~5~-phosphanyl]oxy}-3,3-dimethylbutanoyl]-beta-alanyl}amino)ethyl] 1H-pyrrole-2-carbothioate: A81 (= A87), N115 (≠ L121), S124 (≠ Y130), F227 (≠ L222), M231 (≠ T226), E234 (≠ A229), R235 (≠ A230)
Sites not aligning to the query:
I6Y3Q0 Acyl-CoA dehydrogenase FadE27; ACAD; 3-oxocholest-4-en-26-oyl-CoA dehydrogenase beta subunit; EC 1.3.99.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
25% identity, 99% coverage: 1:366/371 of query aligns to 1:371/373 of I6Y3Q0
- R251 (= R253) binding
- H327 (≠ Q322) binding
- G331 (= G326) binding
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
26% identity, 93% coverage: 1:345/371 of query aligns to 1:361/380 of 4l1fA
- active site: L125 (≠ Y123), T126 (≠ Q124), G242 (= G227)
- binding coenzyme a persulfide: T132 (≠ Y130), H179 (vs. gap), F232 (≠ L220), M236 (≠ V224), E237 (≠ D225), L239 (vs. gap), D240 (vs. gap), R243 (≠ I228)
- binding flavin-adenine dinucleotide: F123 (≠ L121), L125 (≠ Y123), T126 (≠ Q124), G131 (≠ R129), T132 (≠ Y130), F156 (≠ I154), I157 (≠ V155), T158 (≠ A156), R268 (= R253), Q270 (= Q255), F271 (= F256), I275 (= I260), F278 (= F263), L281 (= L266), Q336 (= Q322), I337 (≠ L323), G340 (= G326), I358 (≠ L342)
- binding 1,3-propandiol: L5 (≠ F5), Q10 (≠ E10)
Sites not aligning to the query:
6wy9B Tcur3481-tcur3483 steroid acad g363a variant (see paper)
28% identity, 96% coverage: 5:361/371 of query aligns to 2:356/361 of 6wy9B
6cy8B Crystal structure of fad-dependent dehydrogenase (see paper)
27% identity, 80% coverage: 37:332/371 of query aligns to 24:336/370 of 6cy8B
- active site: I115 (≠ Y123), S116 (≠ Q124), E232 (≠ A229)
- binding flavin-adenine dinucleotide: N113 (≠ L121), I115 (≠ Y123), S116 (≠ Q124), G121 (≠ R129), S122 (≠ Y130), Y146 (≠ I154), T148 (≠ A156), L199 (≠ V202)
- binding 4'-phosphopantetheine: S122 (≠ Y130), F225 (≠ L222), A226 (= A223), R233 (≠ A230)
Sites not aligning to the query:
4ktoA Crystal structure of a putative isovaleryl-coa dehydrogenase (psi- nysgrc-012251) from sinorhizobium meliloti 1021
26% identity, 75% coverage: 1:278/371 of query aligns to 6:290/377 of 4ktoA
- active site: M130 (≠ Y123), S131 (≠ Q124), E239 (≠ G227)
- binding flavin-adenine dinucleotide: L128 (= L121), M130 (≠ Y123), S131 (≠ Q124), M155 (≠ S153), W156 (≠ I154), T158 (≠ A156), R265 (= R253), F268 (= F256), I272 (= I260), F275 (= F263), M278 (≠ L266)
Sites not aligning to the query:
7szvA Crystal structure of acyl-coa dehydrogenase from mycobacterium marinum in complex with fda
26% identity, 83% coverage: 45:352/371 of query aligns to 41:359/372 of 7szvA
- binding dihydroflavine-adenine dinucleotide: L122 (≠ Y123), T123 (≠ Q124), F153 (≠ A140), I154 (≠ S141), T155 (≠ A142), K194 (≠ R181), R261 (= R253), S263 (≠ Q255), Y271 (≠ F263), I274 (≠ L266), Q329 (= Q322), V330 (≠ L323), G332 (= G325), G333 (= G326), T358 (≠ D351)
Sites not aligning to the query:
2pg0A Crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus
24% identity, 88% coverage: 7:333/371 of query aligns to 7:348/380 of 2pg0A
- active site: M124 (≠ Y123), T125 (≠ Q124), E243 (vs. gap)
- binding flavin-adenine dinucleotide: I122 (≠ L121), M124 (≠ Y123), T125 (≠ Q124), G130 (≠ R129), S131 (≠ Y130), F155 (≠ I154), I156 (≠ V155), T157 (≠ A156), R269 (= R253), F272 (= F256), F279 (= F263), Q337 (= Q322), L338 (= L323), G340 (= G325), G341 (= G326)
Sites not aligning to the query:
8sgrA Human liver mitochondrial isovaleryl-coa dehydrogenase (see paper)
25% identity, 76% coverage: 5:285/371 of query aligns to 12:311/393 of 8sgrA
Sites not aligning to the query:
1ivhA Structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity (see paper)
25% identity, 76% coverage: 5:285/371 of query aligns to 8:307/387 of 1ivhA
- active site: M130 (≠ Y123), S131 (≠ Q124), E249 (≠ G227)
- binding coenzyme a persulfide: S137 (≠ Y130), S185 (vs. gap), R186 (≠ G172), V239 (≠ L217), Y240 (≠ A218), M243 (≠ E221), E249 (≠ G227), R250 (≠ I228)
- binding flavin-adenine dinucleotide: L128 (= L121), M130 (≠ Y123), S131 (≠ Q124), G136 (≠ R129), S137 (≠ Y130), W161 (≠ I154), T163 (≠ A156), R275 (= R253), F278 (= F256), F285 (= F263), M288 (≠ L266)
Sites not aligning to the query:
P26440 Isovaleryl-CoA dehydrogenase, mitochondrial; IVD; Butyryl-CoA dehydrogenase; EC 1.3.8.4; EC 1.3.8.1 from Homo sapiens (Human) (see 5 papers)
25% identity, 76% coverage: 5:285/371 of query aligns to 45:344/426 of P26440
- 165:174 (vs. 121:130, 40% identical) binding
- S174 (≠ Y130) binding
- WIT 198:200 (≠ IVA 154:156) binding
- SR 222:223 (≠ -G 172) binding
- G250 (≠ A199) to A: in IVA; uncertain significance
- Y277 (≠ A218) binding
- DLER 284:287 (≠ DTGI 225:228) binding
- E286 (≠ G227) active site, Proton acceptor; mutation to D: Residual isovaleryl-CoA dehydrogenase activity.; mutation to G: Loss of isovaleryl-CoA dehydrogenase activity. Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 407-E.; mutation to Q: Loss of isovaleryl-CoA dehydrogenase activity.
- A291 (≠ C232) to V: in IVA; uncertain significance; dbSNP:rs886042098
- R312 (= R253) binding
- Q323 (= Q264) binding
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
- 379 I → T: in IVA; uncertain significance
- 380:384 binding
- 398 R → Q: in IVA; uncertain significance; dbSNP:rs1477527791
- 403 Y → N: in IVA; uncertain significance
- 407 A→E: Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 286-D.
- 407:408 binding
- 409:411 binding
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
24% identity, 78% coverage: 45:333/371 of query aligns to 41:342/374 of 5lnxD
- active site: L122 (≠ Y123), T123 (≠ Q124), G239 (= G227)
- binding flavin-adenine dinucleotide: L122 (≠ Y123), T123 (≠ Q124), G128 (≠ R129), S129 (≠ Y130), F153 (≠ I154), T155 (≠ A156), R265 (= R253), Q267 (= Q255), F268 (= F256), I272 (= I260), N275 (≠ F263), I278 (≠ L266), Q331 (= Q322), I332 (≠ L323), G335 (= G326)
Sites not aligning to the query:
1bucA Three-dimensional structure of butyryl-coa dehydrogenase from megasphaera elsdenii (see paper)
26% identity, 93% coverage: 1:345/371 of query aligns to 1:365/383 of 1bucA
- active site: L128 (≠ Y123), T129 (≠ Q124), G246 (= G227)
- binding acetoacetyl-coenzyme a: L96 (≠ I91), F126 (≠ L121), G134 (≠ R129), T135 (≠ Y130), T162 (≠ A156), N182 (vs. gap), H183 (vs. gap), F236 (≠ L217), M240 (≠ E221), M241 (≠ L222), L243 (≠ V224), D244 (= D225), T317 (≠ A296)
- binding flavin-adenine dinucleotide: F126 (≠ L121), L128 (≠ Y123), T129 (≠ Q124), G134 (≠ R129), T135 (≠ Y130), F160 (≠ I154), T162 (≠ A156)
Sites not aligning to the query:
Q06319 Acyl-CoA dehydrogenase, short-chain specific; Butyryl-CoA dehydrogenase; BCAD; SCAD; EC 1.3.8.1 from Megasphaera elsdenii (see paper)
26% identity, 93% coverage: 1:345/371 of query aligns to 1:365/383 of Q06319
Sites not aligning to the query:
- 367 active site, Proton acceptor; E→Q: Loss of activity.
3owaC Crystal structure of acyl-coa dehydrogenase complexed with fad from bacillus anthracis
26% identity, 80% coverage: 38:333/371 of query aligns to 54:382/587 of 3owaC
- active site: L143 (≠ Y123), T144 (≠ Q124), G258 (= G227)
- binding flavin-adenine dinucleotide: Y141 (≠ L121), L143 (≠ Y123), T144 (≠ Q124), G149 (≠ R129), S150 (≠ Y130), W176 (≠ I154), I177 (≠ V155), T178 (≠ A156), R284 (= R253), F287 (= F256), I291 (= I260), F294 (= F263), Q371 (= Q322), I372 (≠ L323), G375 (= G326)
Sites not aligning to the query:
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
25% identity, 93% coverage: 1:345/371 of query aligns to 1:360/379 of 1ukwB
- active site: L124 (≠ Y123), S125 (≠ Q124), T241 (≠ G227)
- binding cobalt (ii) ion: D145 (≠ A144), H146 (≠ G145)
- binding flavin-adenine dinucleotide: F122 (≠ L121), L124 (≠ Y123), S125 (≠ Q124), G130 (≠ R129), S131 (≠ Y130), W155 (≠ I154), S157 (≠ A156), K200 (≠ Y191), L357 (= L342)
Sites not aligning to the query:
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
25% identity, 93% coverage: 1:345/371 of query aligns to 1:360/379 of 1ukwA
Sites not aligning to the query:
4irnA Crystal structure of the prolyl acyl carrier protein oxidase anab (see paper)
24% identity, 78% coverage: 38:328/371 of query aligns to 34:341/378 of 4irnA
- active site: A124 (≠ Y123), T125 (≠ Q124), E241 (≠ G227)
- binding flavin-adenine dinucleotide: H122 (≠ L121), A124 (≠ Y123), T125 (≠ Q124), G130 (≠ R129), S131 (≠ Y130), Y155 (≠ I154), T157 (≠ A156), H267 (≠ R253), Q269 (= Q255), F270 (= F256), I274 (= I260), F277 (= F263), V280 (≠ L266), E335 (≠ Q322), I336 (≠ L323), G338 (= G325), A339 (≠ G326)
Sites not aligning to the query:
Query Sequence
>Ac3H11_1712 FitnessBrowser__acidovorax_3H11:Ac3H11_1712
MDFDFSDDQEQLRDAVRKWVDKGYTFERRRATVAAGGFDRAAWGELAELGLTALTVPEAH
DGMGQGAIDAMVVAEELGRGMVLEPIAQAFIASSVLSHCAPADVQSAWLPRVASGEALVV
LAYQERKARYRLDVCEAKAASAPAGYAVTATKSIVAAGDQADAFIVPAQLDGKIALFLVE
RSAAGVTTRGYVTQDGSRAAEVQLANAPATLITTDGLAALELAVDTGIAATCAEAVGVMD
KTVALTVEYMNQRKQFGVFIASFQALRHRVADMKMQLELARSMSYYASLKLGAPAAERRA
AMARAKVQLGQSMRFVGQQSVQLHGGIGVTDEYIGSHYFKKLTQLEMTFGDTLHHLGEVS
ARMQDTAGVFA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory