SitesBLAST
Comparing Ac3H11_1770 FitnessBrowser__acidovorax_3H11:Ac3H11_1770 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
35% identity, 92% coverage: 22:308/313 of query aligns to 30:320/514 of P04968
- K62 (= K55) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N80) binding
- GGGGL 188:192 (= GGGGL 180:184) binding
- S315 (≠ C303) binding
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
30% identity, 97% coverage: 5:308/313 of query aligns to 19:328/339 of Q7XSN8
- E219 (= E202) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ T208) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
35% identity, 92% coverage: 22:308/313 of query aligns to 26:316/494 of 1tdjA
- active site: K58 (= K55), A83 (≠ G78), E209 (= E202), S213 (≠ A206), C215 (≠ T208), G237 (≠ S230), L310 (= L302), S311 (≠ C303)
- binding pyridoxal-5'-phosphate: F57 (= F54), K58 (= K55), N85 (= N80), G184 (= G180), G185 (= G181), G186 (= G182), G187 (= G183), G237 (≠ S230), E282 (= E275), S311 (≠ C303), G312 (= G304)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
29% identity, 92% coverage: 21:308/313 of query aligns to 26:310/310 of 7nbgDDD
- active site: K53 (= K55), S76 (≠ G78), E202 (= E202), A206 (= A206), D208 (≠ T208), G231 (= G225), L304 (= L302), S305 (≠ C303)
- binding calcium ion: E202 (= E202), A206 (= A206), D208 (≠ T208)
- binding magnesium ion: N239 (≠ I239)
- binding ortho-xylene: S76 (≠ G78), Q81 (≠ I83), I96 (≠ V98), Y113 (≠ L115)
- binding pyridoxal-5'-phosphate: F52 (= F54), K53 (= K55), N78 (= N80), G177 (= G180), G178 (= G181), G179 (= G182), G180 (= G183), M181 (≠ L184), G231 (= G225), V232 (= V226), E275 (= E275), T277 (≠ A277), S305 (≠ C303), G306 (= G304)
Sites not aligning to the query:
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
29% identity, 92% coverage: 21:308/313 of query aligns to 27:311/322 of 3l6bA
- active site: K54 (= K55), S77 (≠ G78), E203 (= E202), A207 (= A206), D209 (≠ T208), G232 (= G225), T278 (≠ A277), L305 (= L302), S306 (≠ C303)
- binding malonate ion: K54 (= K55), S76 (= S77), S77 (≠ G78), N79 (= N80), H80 (≠ A81), R128 (≠ E131), G232 (= G225)
- binding manganese (ii) ion: E203 (= E202), A207 (= A206), D209 (≠ T208)
- binding pyridoxal-5'-phosphate: F53 (= F54), K54 (= K55), N79 (= N80), G178 (= G180), G179 (= G181), G180 (= G182), G181 (= G183), M182 (≠ L184), V233 (= V226), E276 (= E275), T278 (≠ A277), S306 (≠ C303), G307 (= G304)
6zspAAA serine racemase bound to atp and malonate. (see paper)
29% identity, 92% coverage: 21:308/313 of query aligns to 26:308/320 of 6zspAAA
- active site: K53 (= K55), S74 (≠ G78), E200 (= E202), A204 (= A206), D206 (≠ T208), G229 (= G225), L302 (= L302), S303 (≠ C303)
- binding adenosine-5'-triphosphate: S28 (≠ T23), S29 (≠ T24), I30 (≠ P25), K48 (≠ V50), T49 (≠ G51), Q79 (≠ I83), Y111 (≠ L115), E266 (≠ K268), R267 (≠ E269), K269 (= K271), N306 (= N306)
- binding magnesium ion: E200 (= E202), A204 (= A206), D206 (≠ T208)
- binding malonate ion: K53 (= K55), S73 (= S77), S74 (≠ G78), N76 (= N80), H77 (≠ A81), R125 (≠ E131), G229 (= G225), S232 (≠ A228)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
29% identity, 92% coverage: 21:308/313 of query aligns to 26:315/320 of 7nbhAAA
- active site: K53 (= K55), S81 (≠ G78), E207 (= E202), A211 (= A206), D213 (≠ T208), G236 (= G225), L309 (= L302), S310 (≠ C303)
- binding calcium ion: E207 (= E202), A211 (= A206), D213 (≠ T208)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ G78), G85 (= G82), Q86 (≠ I83), K111 (= K108), I115 (≠ L112), Y118 (≠ L115), D235 (≠ G224), P281 (= P276), N313 (= N306), V314 (≠ F307), D315 (= D308)
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
29% identity, 92% coverage: 21:308/313 of query aligns to 26:315/322 of 7nbgAAA
- active site: K53 (= K55), S81 (≠ G78), E207 (= E202), A211 (= A206), D213 (≠ T208), G236 (= G225), L309 (= L302), S310 (≠ C303)
- binding calcium ion: E207 (= E202), A211 (= A206), D213 (≠ T208)
- binding pyridoxal-5'-phosphate: F52 (= F54), K53 (= K55), N83 (= N80), G182 (= G180), G183 (= G181), G184 (= G182), G185 (= G183), M186 (≠ L184), G236 (= G225), V237 (= V226), T282 (≠ A277), S310 (≠ C303), G311 (= G304)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ G78), G85 (= G82), Q86 (≠ I83), I101 (≠ V98), K111 (= K108), I115 (≠ L112), Y118 (≠ L115)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
29% identity, 92% coverage: 21:308/313 of query aligns to 26:315/323 of 7nbfAAA
- active site: K53 (= K55), S81 (≠ G78), E207 (= E202), A211 (= A206), D213 (≠ T208), G236 (= G225), L309 (= L302), S310 (≠ C303)
- binding calcium ion: E207 (= E202), A211 (= A206), D213 (≠ T208)
- binding magnesium ion: N244 (≠ I239)
- binding pyridoxal-5'-phosphate: F52 (= F54), K53 (= K55), N83 (= N80), G182 (= G180), G183 (= G181), G184 (= G182), G185 (= G183), M186 (≠ L184), G236 (= G225), V237 (= V226), T282 (≠ A277), S310 (≠ C303), G311 (= G304)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: L26 (= L21), T27 (≠ R22), F46 (≠ L48)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
29% identity, 92% coverage: 21:308/313 of query aligns to 26:315/323 of 7nbdAAA
- active site: K53 (= K55), S81 (≠ G78), E207 (= E202), A211 (= A206), D213 (≠ T208), G236 (= G225), L309 (= L302), S310 (≠ C303)
- binding calcium ion: E207 (= E202), A211 (= A206), D213 (≠ T208)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (= W267), L278 (≠ A273), V314 (≠ F307)
- binding magnesium ion: N244 (≠ I239)
- binding pyridoxal-5'-phosphate: F52 (= F54), K53 (= K55), N83 (= N80), G182 (= G180), G183 (= G181), G184 (= G182), G185 (= G183), M186 (≠ L184), G236 (= G225), V237 (= V226), E280 (= E275), T282 (≠ A277), S310 (≠ C303), G311 (= G304)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
29% identity, 92% coverage: 21:308/313 of query aligns to 26:315/323 of 7nbcCCC
- active site: K53 (= K55), S81 (≠ G78), E207 (= E202), A211 (= A206), D213 (≠ T208), G236 (= G225), L309 (= L302), S310 (≠ C303)
- binding biphenyl-4-ylacetic acid: T78 (≠ I75), H79 (≠ A76), H84 (≠ A81), V148 (≠ A145), H149 (= H146), P150 (≠ A147)
- binding calcium ion: E207 (= E202), A211 (= A206), D213 (≠ T208)
- binding pyridoxal-5'-phosphate: F52 (= F54), K53 (= K55), N83 (= N80), G182 (= G180), G183 (= G181), G184 (= G182), G185 (= G183), M186 (≠ L184), G236 (= G225), V237 (= V226), T282 (≠ A277), S310 (≠ C303), G311 (= G304)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
29% identity, 92% coverage: 21:308/313 of query aligns to 26:315/323 of 7nbcAAA
- active site: K53 (= K55), S81 (≠ G78), E207 (= E202), A211 (= A206), D213 (≠ T208), G236 (= G225), L309 (= L302), S310 (≠ C303)
- binding calcium ion: E207 (= E202), A211 (= A206), D213 (≠ T208)
- binding magnesium ion: N244 (≠ I239)
- binding pyridoxal-5'-phosphate: F52 (= F54), K53 (= K55), N83 (= N80), G182 (= G180), G183 (= G181), G184 (= G182), G185 (= G183), M186 (≠ L184), G236 (= G225), V237 (= V226), T282 (≠ A277), S310 (≠ C303), G311 (= G304)
Sites not aligning to the query:
1ve5A Crystal structure of t.Th. Hb8 threonine deaminase
39% identity, 84% coverage: 46:308/313 of query aligns to 41:305/308 of 1ve5A
- active site: K50 (= K55), S56 (≠ Y61), S72 (≠ G78), E200 (= E202), A204 (= A206), D206 (≠ T208), G229 (≠ S230), L299 (= L302), S300 (≠ C303)
- binding calcium ion: E200 (= E202), A204 (= A206), D206 (≠ T208)
- binding pyridoxal-5'-phosphate: F49 (= F54), K50 (= K55), N74 (= N80), G175 (= G180), G176 (= G181), G177 (= G182), G178 (= G183), E274 (= E275), T276 (≠ A277), S300 (≠ C303), G301 (= G304)
5cvcA Structure of maize serine racemase (see paper)
30% identity, 98% coverage: 5:312/313 of query aligns to 3:316/329 of 5cvcA
- active site: K52 (= K55), S77 (≠ G78), E203 (= E202), A207 (= A206), D209 (≠ T208), G231 (≠ S230), V306 (≠ L302), S307 (≠ C303)
- binding magnesium ion: E203 (= E202), A207 (= A206), D209 (≠ T208)
- binding pyridoxal-5'-phosphate: F51 (= F54), K52 (= K55), N79 (= N80), S178 (≠ G180), G179 (= G181), G180 (= G182), G181 (= G183), L232 (= L231), E275 (= E275), S307 (≠ C303), G308 (= G304)
3hmkA Crystal structure of serine racemase (see paper)
29% identity, 94% coverage: 21:313/313 of query aligns to 27:321/321 of 3hmkA
- active site: K54 (= K55), S82 (≠ G78), E208 (= E202), A212 (= A206), D214 (≠ T208), G237 (= G225), T283 (≠ A277), L310 (= L302), S311 (≠ C303)
- binding manganese (ii) ion: E208 (= E202), A212 (= A206), D214 (≠ T208)
- binding pyridoxal-5'-phosphate: F53 (= F54), K54 (= K55), N84 (= N80), G183 (= G180), G184 (= G181), G185 (= G182), G186 (= G183), M187 (≠ L184), G237 (= G225), V238 (= V226), T283 (≠ A277), S311 (≠ C303), G312 (= G304)
Q9QZX7 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Mus musculus (Mouse) (see paper)
30% identity, 93% coverage: 21:312/313 of query aligns to 29:322/339 of Q9QZX7
- C113 (≠ A107) modified: S-nitrosocysteine; mutation to S: Abolishes S-nitrosylation.
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
32% identity, 86% coverage: 40:308/313 of query aligns to 41:314/326 of 2gn2A
- active site: K56 (= K55), A81 (≠ G78), Q207 (≠ E202), V211 (≠ A206), G213 (≠ T208), G235 (≠ S230), I308 (≠ L302), S309 (≠ C303)
- binding cytidine-5'-monophosphate: R51 (≠ V50), T52 (≠ G51), G53 (= G52), A114 (≠ R111), D117 (≠ A114), Y118 (≠ L115), N312 (= N306)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
29% identity, 92% coverage: 20:308/313 of query aligns to 19:309/319 of A4F2N8
- K53 (= K55) mutation to A: Loss of enzymatic activity.
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
30% identity, 92% coverage: 20:308/313 of query aligns to 18:308/318 of 1wtcA
- active site: K52 (= K55), S77 (≠ G78), E203 (= E202), G207 (≠ A206), D209 (≠ T208), G231 (≠ S230), I302 (≠ L302), S303 (≠ C303)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ R22), K47 (≠ V50), M48 (≠ G51), A109 (= A110), A110 (≠ R111), Y114 (≠ L115)
- binding magnesium ion: E203 (= E202), G207 (≠ A206), D209 (≠ T208)
- binding pyridoxal-5'-phosphate: F51 (= F54), K52 (= K55), N79 (= N80), G178 (= G180), G179 (= G181), G180 (= G182), G181 (= G183), G231 (≠ S230), E276 (= E275), T278 (≠ A277), S303 (≠ C303)
1v71A Crystal structure of s.Pombe serine racemase
30% identity, 92% coverage: 20:308/313 of query aligns to 18:308/318 of 1v71A
- active site: K52 (= K55), S77 (≠ G78), E203 (= E202), G207 (≠ A206), D209 (≠ T208), G231 (≠ S230), I302 (≠ L302), S303 (≠ C303)
- binding magnesium ion: E203 (= E202), G207 (≠ A206), D209 (≠ T208)
- binding pyridoxal-5'-phosphate: F51 (= F54), K52 (= K55), N79 (= N80), G178 (= G180), G179 (= G181), G180 (= G182), G181 (= G183), G231 (≠ S230), E276 (= E275), T278 (≠ A277), S303 (≠ C303), G304 (= G304)
Query Sequence
>Ac3H11_1770 FitnessBrowser__acidovorax_3H11:Ac3H11_1770
MIDRAAIAAARRQLATQPDFLRTTPLMRVSGKTLGVDCAEVWLKLEHLQVGGSFKARGML
YRLLANPVPESGVIIASGGNAGIAVAAAAQALGVRCEVFVPEVSPEAKRARLRALGAEVI
VTGAAYSQAFEACVARQKTTGALQAHAYDQPEVVAGAGTLALELEEQGGRLPDTVLVSVG
GGGLIGGVAAWVESRAHVVALEPERAPTLHAARAAGQPVDVEVGGVAADSLGAKRIGAIG
WEVSQRHVHDALLLPDDAIRAAQLWLWKELKLAVEPAAALGLAALQTGAYKPQPQETVAL
ILCGANFDPANLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory