Comparing Ac3H11_1815 FitnessBrowser__acidovorax_3H11:Ac3H11_1815 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WIC7 Glucosyl-3-phosphoglycerate phosphatase; Mannosyl-3-phosphoglycerate phosphatase; EC 3.1.3.85; EC 3.1.3.70 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
40% identity, 72% coverage: 1:154/213 of query aligns to 1:161/223 of P9WIC7
Sites not aligning to the query:
4pzaB The complex structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c with inorganic phosphate (see paper)
40% identity, 72% coverage: 2:154/213 of query aligns to 1:160/217 of 4pzaB
4qihA The structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 (see paper)
40% identity, 71% coverage: 3:154/213 of query aligns to 1:159/209 of 4qihA
6m1xC Crystal structure of phosphoserine phosphatase in complex with 3- phosphoglyceric acid from entamoeba histolytica (see paper)
29% identity, 93% coverage: 4:202/213 of query aligns to 2:196/196 of 6m1xC
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
35% identity, 81% coverage: 3:174/213 of query aligns to 1:170/207 of 1h2fA
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
35% identity, 81% coverage: 3:174/213 of query aligns to 1:170/207 of 1h2eA
4ij6A Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from hydrogenobacter thermophilus tk-6 in complex with l-phosphoserine (see paper)
29% identity, 83% coverage: 4:180/213 of query aligns to 2:178/207 of 4ij6A
5zr2C Crystal structure of phosphoserine phosphatase mutant (h9a) from entamoeba histolytica in complex with phosphoserine (see paper)
28% identity, 93% coverage: 4:202/213 of query aligns to 2:196/198 of 5zr2C
Q7ZVE3 Fructose-2,6-bisphosphatase TIGAR B; TP53-induced glycolysis and apoptosis regulator B; EC 3.1.3.46 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
34% identity, 66% coverage: 6:145/213 of query aligns to 6:146/257 of Q7ZVE3
Q9MB58 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase; 6PF-2-K/Fru-2,6-P2ase; AtF2KP; PFK/FBPase; EC 2.7.1.105; EC 3.1.3.46 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
33% identity, 73% coverage: 6:160/213 of query aligns to 553:704/744 of Q9MB58
Sites not aligning to the query:
P62707 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Escherichia coli (strain K12) (see 6 papers)
29% identity, 76% coverage: 1:161/213 of query aligns to 1:193/250 of P62707
1e59A E.Coli cofactor-dependent phosphoglycerate mutase complexed with vanadate (see paper)
29% identity, 75% coverage: 3:161/213 of query aligns to 1:191/239 of 1e59A
1fbtA The bisphosphatase domain of the bifunctional rat liver 6- phosphofructo-2-kinase/fructose-2,6-bisphosphatase (see paper)
31% identity, 72% coverage: 6:159/213 of query aligns to 3:149/190 of 1fbtA
1tipA The bisphosphatase domain of the bifunctional rat liver 6- phosphofructo-2-kinase/fructose-2,6-bisphosphatase (see paper)
31% identity, 72% coverage: 6:159/213 of query aligns to 4:150/191 of 1tipA
1c81A Michaelis complex of fructose-2,6-bisphosphatase
31% identity, 72% coverage: 6:159/213 of query aligns to 4:150/191 of 1c81A
1c80A Regulatory complex of fructose-2,6-bisphosphatase
31% identity, 72% coverage: 6:159/213 of query aligns to 4:150/191 of 1c80A
1c7zA Regulatory complex of fructose-2,6-bisphosphatase
31% identity, 72% coverage: 6:159/213 of query aligns to 4:150/191 of 1c7zA
P07953 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1; 6PF-2-K/Fru-2,6-P2ase 1; PFK/FBPase 1; 6PF-2-K/Fru-2,6-P2ase liver isozyme; EC 2.7.1.105; EC 3.1.3.46 from Rattus norvegicus (Rat) (see 3 papers)
31% identity, 72% coverage: 6:159/213 of query aligns to 254:400/471 of P07953
Sites not aligning to the query:
P9WIC9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
28% identity, 73% coverage: 6:161/213 of query aligns to 7:192/249 of P9WIC9
3fdzA Crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b with bound 2,3-diphosphoglyceric acid and 3- phosphoglyceric acid (see paper)
29% identity, 74% coverage: 5:161/213 of query aligns to 3:191/230 of 3fdzA
>Ac3H11_1815 FitnessBrowser__acidovorax_3H11:Ac3H11_1815
MQATRIVAIRHGETAWNVDTRIQGHLDIPLNTTGLWQADQVARALADEPITAIYTSDLKR
AHATAQAVARSTGAPLTTHTGLRERSFGHFQGRTFAEIEAELPEDAYRWRKRDPHYAPEG
GESLVTLRERIERTVAQLAQQHLDEQVVMVAHGGVLDVLYRLATRQDIQAPRTWQLSNAA
INRLLWTPDGLSLVGWADTQHLDNNALRDETHS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory