SitesBLAST
Comparing Ac3H11_1839 FitnessBrowser__acidovorax_3H11:Ac3H11_1839 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8cqxA Ribokinase from t.Sp mutant a92g
48% identity, 94% coverage: 9:302/314 of query aligns to 2:294/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (= N188), T217 (= T224), G219 (= G226), A220 (= A227), G222 (= G229), F250 (= F258), N272 (≠ I280), G275 (≠ A283), A276 (= A284), T279 (≠ V287)
- binding magnesium ion: D242 (= D250), T244 (= T252), A278 (≠ C286), S287 (= S295)
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
44% identity, 94% coverage: 8:302/314 of query aligns to 3:298/306 of 4xckA
- active site: A249 (= A253), A250 (= A254), G251 (= G255), D252 (= D256)
- binding adenosine-5'-diphosphate: T220 (= T224), G222 (= G226), S223 (≠ A227), V242 (= V246), T247 (= T251), A250 (= A254), F254 (= F258), H276 (≠ I280), A279 (= A283), V283 (= V287)
- binding alpha-D-ribofuranose: N11 (= N16), D13 (= D18), G39 (= G44), K40 (= K45), N43 (= N48), A95 (= A100), I107 (= I112), I109 (≠ V114), E140 (= E144), T248 (= T252), D252 (= D256)
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
43% identity, 95% coverage: 5:302/314 of query aligns to 3:301/309 of P0A9J6
1gqtB Activation of ribokinase by monovalent cations (see paper)
43% identity, 95% coverage: 5:302/314 of query aligns to 2:300/307 of 1gqtB
- active site: A251 (= A253), A252 (= A254), G253 (= G255), D254 (= D256)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N188), T222 (= T224), G224 (= G226), S225 (≠ A227), A252 (= A254), G253 (= G255), H278 (≠ I280), A281 (= A283)
- binding cesium ion: D248 (= D250), I250 (≠ T252), A284 (≠ C286), R287 (≠ Q289), S293 (= S295)
- binding alpha-D-ribofuranose: N13 (= N16), D15 (= D18), G41 (= G44), N45 (= N48), E142 (= E144), D254 (= D256)
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
43% identity, 94% coverage: 9:302/314 of query aligns to 4:298/305 of 1rk2A
- active site: A249 (= A253), A250 (= A254), G251 (= G255), D252 (= D256)
- binding adenosine-5'-diphosphate: T220 (= T224), G222 (= G226), S223 (≠ A227), A250 (= A254), G251 (= G255), H276 (≠ I280), A279 (= A283)
- binding tetrafluoroaluminate ion: G213 (= G217), R215 (≠ A219)
- binding magnesium ion: D246 (= D250), A282 (≠ C286), R285 (≠ Q289), S291 (= S295)
- binding alpha-D-ribofuranose: N11 (= N16), D13 (= D18), G38 (= G43), G39 (= G44), K40 (= K45), N43 (= N48), E140 (= E144), D252 (= D256)
6znxC Ribokinase from thermus species
44% identity, 94% coverage: 9:302/314 of query aligns to 2:259/265 of 6znxC
6a8cA Ribokinase from leishmania donovani with adp (see paper)
37% identity, 93% coverage: 6:297/314 of query aligns to 13:317/327 of 6a8cA
- binding adenosine-5'-diphosphate: G245 (= G226), A246 (= A227), T271 (= T251), A274 (= A254), G275 (= G255), N300 (≠ I280), A303 (= A283)
- binding glycerol: D25 (= D18), S42 (≠ A35), S44 (≠ A37), G50 (= G43), G51 (= G44), N55 (= N48)
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
37% identity, 93% coverage: 6:297/314 of query aligns to 13:317/327 of 6a8bA
- binding phosphomethylphosphonic acid adenylate ester: G245 (= G226), A246 (= A227), T271 (= T251), A274 (= A254), G275 (= G255), N300 (≠ I280), A303 (= A283), V307 (= V287)
- binding glycerol: D25 (= D18), G50 (= G43), G51 (= G44), N55 (= N48), N157 (≠ F143), I159 (≠ T145), E190 (vs. gap)
6a8aA Ribokinase from leishmania donovani with atp (see paper)
37% identity, 93% coverage: 6:297/314 of query aligns to 13:317/327 of 6a8aA
- binding adenosine-5'-triphosphate: N207 (= N188), T243 (= T224), G245 (= G226), A246 (= A227), G248 (= G229), T271 (= T251), G273 (≠ A253), A274 (= A254), G275 (= G255), N300 (≠ I280), A303 (= A283), V307 (= V287)
- binding glycerol: D25 (= D18), G50 (= G43), G51 (= G44), N55 (= N48)
5c3yA Structure of human ribokinase crystallized with amppnp
36% identity, 93% coverage: 9:299/314 of query aligns to 4:300/306 of 5c3yA
- active site: G252 (≠ A253), A253 (= A254), G254 (= G255), D255 (= D256)
- binding amp phosphoramidate: T221 (= T224), G223 (= G226), V245 (= V246), T250 (= T251), G254 (= G255), N281 (≠ I280), A284 (= A283), A285 (= A284)
6wk0B Crystal structure of human ribokinase in complex with amppcp and ribose
36% identity, 93% coverage: 9:299/314 of query aligns to 5:301/311 of 6wk0B
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N188), T222 (= T224), G224 (= G226), A225 (= A227), G227 (= G229), T243 (≠ G243), V246 (= V246), A254 (= A254), G255 (= G255), N282 (≠ I280), A285 (= A283), A286 (= A284), V289 (= V287)
- binding alpha-D-ribofuranose: D14 (= D18), G40 (= G44), K41 (= K45), N44 (= N48), A96 (= A100), E141 (= E144), D256 (= D256)
5c41A Crystal structure of human ribokinase in complex with amppcp in p21 spacegroup and with 4 protomers
36% identity, 93% coverage: 9:299/314 of query aligns to 5:301/317 of 5c41A
- active site: G253 (≠ A253), A254 (= A254), G255 (= G255), D256 (= D256)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N188), T222 (= T224), G224 (= G226), A225 (= A227), G227 (= G229), V246 (= V246), G255 (= G255), N282 (≠ I280), A285 (= A283), A286 (= A284)
6wjzA Crystal structure of human ribokinase in complex with ampcp
36% identity, 93% coverage: 9:299/314 of query aligns to 5:301/315 of 6wjzA
- binding phosphomethylphosphonic acid adenosyl ester: N186 (= N188), T222 (= T224), G224 (= G226), A225 (= A227), G227 (= G229), T243 (≠ G243), V246 (= V246), A254 (= A254), G255 (= G255), N282 (≠ I280), A285 (= A283), A286 (= A284), V289 (= V287)
2fv7A Crystal structure of human ribokinase
36% identity, 93% coverage: 9:299/314 of query aligns to 4:300/308 of 2fv7A
- active site: G252 (≠ A253), A253 (= A254), G254 (= G255), D255 (= D256)
- binding adenosine-5'-diphosphate: N185 (= N188), T221 (= T224), G223 (= G226), G226 (= G229), T242 (≠ G243), V245 (= V246), A253 (= A254), G254 (= G255), N281 (≠ I280), A284 (= A283), A285 (= A284), V288 (= V287)
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
33% identity, 95% coverage: 6:302/314 of query aligns to 2:305/313 of 6ilsB
- binding adenosine-5'-triphosphate: N189 (= N188), K225 (≠ T224), G227 (= G226), I246 (≠ V245), A248 (vs. gap), A257 (= A254), G258 (= G255), F261 (= F258), A286 (= A283), S287 (≠ A284)
- binding alpha-D-ribofuranose: N12 (= N16), D14 (= D18), G40 (= G44), K41 (= K45), N44 (= N48), E144 (= E144), D259 (= D256)
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 95% coverage: 5:302/314 of query aligns to 67:371/379 of A1A6H3
Sites not aligning to the query:
- 1:74 mutation Missing: Loss of ribokinase activity.
Q9H477 Ribokinase; RK; EC 2.7.1.15 from Homo sapiens (Human)
36% identity, 91% coverage: 13:299/314 of query aligns to 22:314/322 of Q9H477
5byfA Crystal structure of human ribokinase in complex with amp
36% identity, 91% coverage: 13:299/314 of query aligns to 10:302/313 of 5byfA
6xk2A Crystal structure of ribokinase from cryptococcus neoformans var. Grubii serotype a in complex with adp
32% identity, 96% coverage: 4:304/314 of query aligns to 1:318/320 of 6xk2A
3ikhA Crystal structure of ribokinase in complex with atp and glycerol in the active site from klebsiella pneumoniae
31% identity, 83% coverage: 8:269/314 of query aligns to 3:247/286 of 3ikhA
Sites not aligning to the query:
Query Sequence
>Ac3H11_1839 FitnessBrowser__acidovorax_3H11:Ac3H11_1839
MSANNAPRIAVVGSLNMDLVLQVQHAPGPGETVLADALHLVPGGKGGNQAVACARQGAQV
ALFGRVGDDGYGHTLRAGLDADGIDHSGVQTDTATTTGVAAITVEATGQNRIVVVPGANG
RFVLDATALGAALQGAGGLVLQFETPLRQVLAAAEMAHAAGCPVVLNPSPIQPLPEALWP
LVHTLVVNEVEAAALAGQNVTTPADAAQAAQALRAKGPAQVVVTLGAAGAVAADAAGNRY
HPGLVVRAVDTTAAGDTFLGALAVALARGEPLDAGVREGIRAAALCVTQHGAQPSIPTRA
AVAHSPQPPDWIAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory