Comparing Ac3H11_1841 FitnessBrowser__acidovorax_3H11:Ac3H11_1841 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
37% identity, 49% coverage: 22:454/892 of query aligns to 4:403/501 of P04983
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 23% coverage: 36:238/892 of query aligns to 16:216/240 of 4ymuJ
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
30% identity, 27% coverage: 22:260/892 of query aligns to 1:226/348 of 3d31A
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
32% identity, 23% coverage: 33:239/892 of query aligns to 39:244/260 of 7ahdC
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
32% identity, 23% coverage: 36:238/892 of query aligns to 18:218/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
32% identity, 23% coverage: 36:238/892 of query aligns to 18:218/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
32% identity, 23% coverage: 36:238/892 of query aligns to 18:218/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
32% identity, 23% coverage: 36:238/892 of query aligns to 18:218/242 of 2oljA
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
33% identity, 22% coverage: 41:239/892 of query aligns to 46:244/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
33% identity, 22% coverage: 41:239/892 of query aligns to 46:244/382 of 7aheC
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 23% coverage: 33:238/892 of query aligns to 17:221/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 23% coverage: 33:238/892 of query aligns to 18:222/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 23% coverage: 33:238/892 of query aligns to 18:222/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 23% coverage: 33:238/892 of query aligns to 18:222/344 of 6cvlD
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 24% coverage: 21:238/892 of query aligns to 1:216/241 of 4u00A
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
33% identity, 24% coverage: 21:237/892 of query aligns to 3:222/648 of P75831
7arlD Lolcde in complex with lipoprotein and adp (see paper)
32% identity, 24% coverage: 22:237/892 of query aligns to 2:221/222 of 7arlD
7w79A Heme exporter hrtba in complex with mn-amppnp (see paper)
37% identity, 23% coverage: 33:235/892 of query aligns to 20:214/216 of 7w79A
Sites not aligning to the query:
7w78A Heme exporter hrtba in complex with mg-amppnp (see paper)
37% identity, 23% coverage: 33:235/892 of query aligns to 20:214/218 of 7w78A
Sites not aligning to the query:
7mdyC Lolcde nucleotide-bound
32% identity, 24% coverage: 22:237/892 of query aligns to 2:221/226 of 7mdyC
>Ac3H11_1841 FitnessBrowser__acidovorax_3H11:Ac3H11_1841
MPSDAREQPMTPKPPTNTSPPLLAIQAIGKDYTATVLDGVNVELFAGEVLALTGENGAGK
STLSKILCGLEQPTRGGMLLAGQAYAPTSRRDAERHGVRMVMQELGLVPTLTVAENLLMG
RLPHRLGWLQRDVLHAAARAQLAKIGLDSIDPATPVSQLGIGQQQMVEIARNLQDDTRIL
VLDEPTAMLTPRETNYLFEQIAHLTARGVAIIYVSHRLEELRRIADRVAVLRDGRLVDVR
PMAGMSEDDLVQRMVGRVVSDLDHRPRRPVGPVVMSAEGLGRGTAVQGVSLELRAGEIFG
IAGLVGSGRTELVRLLFGADRADRGSVTLHPEFEQKQALPRDGQAQAAIQKIANTPNPAT
AAPRTWQRGFASPLQAIAAGVGLVTEDRKSQGLLLSQPIRINATLSDLSAVSRGGWLQRG
FENRLVQGFVRTLGIRCRSPEQPVGQLSGGNQQKGGVRPLAAPRRPRAAARRTHARRGRG
RPRRAVWRAGPHGPGRPRAAHGVVRPARTHGHGRPHRRDECGPPGGRVRARRVVRAIAAG
GCVLRARRAHQHHTFNFFSCDRMNAPTAPAAPAATPSSASVWRSQLGTYLGLLAVLAGMV
ALFSSLSEYFWSAETFITIANEIPALAVMAVGMTFVLIIAGIDLSVGSVMALAAATSAAA
ILQWGWTVPAAAALALATGLVCGTITGAISVAWRLPSFIVSLGMLEAVRGSAYVVTDSRT
QYVGDAISWLSAPFFGGISFAFLLAVVLVVVAQLVLSRTVFGRCVVGIGTNEEAMRLAGV
DPRPIRVIVFAMTGLLAGLAGLMQSARLEAADPNAGTGMELQVIAAVVIGGTSLMGGRGS
VVNTAFGVLIIAVLEAGLAQVGASEPSKRIITGFVIVAAVIVDTLRQRRAKV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory