Comparing Ac3H11_1882 FitnessBrowser__acidovorax_3H11:Ac3H11_1882 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4b5bA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
82% identity, 99% coverage: 3:294/294 of query aligns to 2:293/293 of 4b5bA
4b4gA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
82% identity, 99% coverage: 3:294/294 of query aligns to 2:293/293 of 4b4gA
4b42A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
82% identity, 99% coverage: 3:294/294 of query aligns to 2:293/293 of 4b42A
4b3uA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
82% identity, 99% coverage: 3:294/294 of query aligns to 8:299/299 of 4b3uA
4asyA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
82% identity, 99% coverage: 3:294/294 of query aligns to 2:293/293 of 4asyA
4b2xB Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
82% identity, 99% coverage: 3:294/294 of query aligns to 11:302/302 of 4b2xB
3zllA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
82% identity, 99% coverage: 3:294/294 of query aligns to 6:297/297 of 3zllA
3zlkA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
82% identity, 99% coverage: 3:294/294 of query aligns to 6:297/297 of 3zlkA
5fu8A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
82% identity, 99% coverage: 3:294/294 of query aligns to 6:297/297 of 5fu8A
4b2wA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
82% identity, 99% coverage: 3:294/294 of query aligns to 6:297/297 of 4b2wA
5fuhA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
82% identity, 99% coverage: 3:294/294 of query aligns to 7:298/298 of 5fuhA
4b4bA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
82% identity, 99% coverage: 3:294/294 of query aligns to 7:298/298 of 4b4bA
4b4mA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
82% identity, 99% coverage: 3:294/294 of query aligns to 5:296/296 of 4b4mA
5fyeA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
82% identity, 99% coverage: 3:294/294 of query aligns to 5:296/296 of 5fyeA
5fu0A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
82% identity, 99% coverage: 3:294/294 of query aligns to 5:296/296 of 5fu0A
5ftvA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
82% identity, 99% coverage: 3:294/294 of query aligns to 5:296/296 of 5ftvA
5ftsA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
82% identity, 99% coverage: 3:294/294 of query aligns to 5:296/296 of 5ftsA
4asjA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
82% identity, 99% coverage: 3:294/294 of query aligns to 1:292/292 of 4asjA
1g3lA The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). Tdp-l-rhamnose complex. (see paper)
82% identity, 99% coverage: 3:294/294 of query aligns to 1:292/292 of 1g3lA
1g2vA The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). Ttp complex. (see paper)
82% identity, 99% coverage: 3:294/294 of query aligns to 1:292/292 of 1g2vA
>Ac3H11_1882 FitnessBrowser__acidovorax_3H11:Ac3H11_1882
MTQRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLGGIRDILIISTPQD
TPRFAQLLGDGSQWGLNLQYAVQPSPDGLAQAFVIGEDFLAGAPSALVLGDNIFYGHDFH
ELLGNARQRTDGASVFAYHVQDPERYGVAEFDDQGKVLSLEEKPKQPKSSYAVTGLYFYD
GQVVQMAKDLKPSPRGELEITDLNRLYLEQGQLNVEIMGRGYAWLDTGTHESLLEAGQFI
ATLEHRQGLKIACPEEISWRSGWIDSEQLARLAQPLSKNGYGQYLQRLLNDKVY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory