SitesBLAST
Comparing Ac3H11_1900 FitnessBrowser__acidovorax_3H11:Ac3H11_1900 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
36% identity, 83% coverage: 46:284/287 of query aligns to 68:305/309 of 4zrnA
- active site: T117 (≠ S96), G119 (= G98), A120 (= A99), Y143 (= Y121), K147 (= K125), Y181 (≠ H159), G185 (= G163)
- binding nicotinamide-adenine-dinucleotide: L73 (= L51), A74 (= A52), A75 (≠ S53), T92 (= T70), S115 (≠ A94), S116 (= S95), Y143 (= Y121), K147 (= K125), Y170 (≠ L148), V173 (≠ P151)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S96), G119 (= G98), A120 (= A99), Y143 (= Y121), N172 (= N150), G185 (= G163), V186 (= V164), H201 (≠ D179), F203 (≠ W181), Y208 (≠ V186), R210 (= R188), V244 (= V223), R267 (= R246), D270 (= D249)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 7, 10, 11, 12, 31, 32, 34, 35, 36, 51, 52
2p5uA Crystal structure of thermus thermophilus hb8 udp-glucose 4-epimerase complex with NAD
39% identity, 83% coverage: 48:284/287 of query aligns to 70:308/311 of 2p5uA
- active site: T117 (≠ S96), G119 (= G98), A120 (= A99), Y143 (= Y121), K147 (= K125), H181 (= H159), G185 (= G163)
- binding nicotinamide-adenine-dinucleotide: Q73 (≠ L51), A74 (= A52), A75 (≠ S53), A77 (≠ T55), S116 (= S95), Y143 (= Y121), K147 (= K125), V173 (≠ P151)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 10, 11, 12, 31, 32, 33, 34, 35, 36, 51, 52
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
37% identity, 82% coverage: 42:276/287 of query aligns to 65:300/307 of 6wjaA
- active site: A118 (≠ S96), A119 (≠ G97), A120 (= A99), F143 (≠ Y121), K147 (= K125)
- binding nicotinamide-adenine-dinucleotide: L74 (= L51), A75 (= A52), A76 (≠ S53), S93 (≠ T70), F143 (≠ Y121), K147 (= K125), F170 (≠ L148), F171 (≠ S149), I173 (≠ P151)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (≠ P57), A120 (= A99), N172 (= N150), G186 (= G163), V187 (= V164), F191 (= F168), T202 (≠ D179), F204 (≠ W181), R211 (= R188), L247 (≠ V223), R270 (= R246), D273 (= D249)
Sites not aligning to the query:
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
37% identity, 82% coverage: 42:276/287 of query aligns to 66:301/308 of 6wj9B
- active site: A119 (≠ S96), A120 (≠ G97), A121 (= A99), F144 (≠ Y121), K148 (= K125)
- binding nicotinamide-adenine-dinucleotide: L75 (= L51), A76 (= A52), A77 (≠ S53), S94 (≠ T70), A117 (= A94), A119 (≠ S96), F144 (≠ Y121), K148 (= K125), F171 (≠ L148), F172 (≠ S149), I174 (≠ P151)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (≠ P57), N173 (= N150), G187 (= G163), V188 (= V164), F192 (= F168), T203 (≠ D179), L204 (≠ V180), F205 (≠ W181), R212 (= R188), L248 (≠ V223), R271 (= R246), D274 (= D249)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 8, 11, 12, 13, 32, 33, 35, 36, 37, 55, 56
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
36% identity, 83% coverage: 46:284/287 of query aligns to 72:309/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ T55), R84 (≠ A58), S121 (= S96), G123 (= G98), Y146 (= Y121), A174 (≠ S149), N175 (= N150), A187 (≠ Q162), G188 (= G163), V189 (= V164), F193 (= F168), R204 (≠ D179), F206 (≠ W181), N211 (≠ V186), R213 (= R188), D248 (≠ V223), R271 (= R246)
- binding nicotinamide-adenine-dinucleotide: L77 (= L51), A78 (= A52), A79 (≠ S53), I81 (≠ T55), T119 (≠ A94), Y146 (= Y121), K150 (= K125), P173 (≠ L148), A174 (≠ S149), V176 (≠ P151)
- binding uridine-5'-diphosphate-glucose: I81 (≠ T55), R84 (≠ A58), S121 (= S96), G123 (= G98), Y146 (= Y121), A174 (≠ S149), N175 (= N150), A187 (≠ Q162), G188 (= G163), V189 (= V164), F193 (= F168), R204 (≠ D179), F206 (≠ W181), N211 (≠ V186), R213 (= R188), D248 (≠ V223), R271 (= R246)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 7, 10, 11, 12, 31, 32, 34, 35, 36, 56, 57
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
36% identity, 83% coverage: 46:284/287 of query aligns to 72:309/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: L77 (= L51), A78 (= A52), A79 (≠ S53), I81 (≠ T55), T119 (≠ A94), Y146 (= Y121), K150 (= K125), P173 (≠ L148), N175 (= N150), V176 (≠ P151)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ T55), R84 (≠ A58), S121 (= S96), G123 (= G98), S124 (≠ A99), Y146 (= Y121), A174 (≠ S149), N175 (= N150), G188 (= G163), V189 (= V164), F193 (= F168), R204 (≠ D179), V205 (= V180), F206 (≠ W181), N211 (≠ V186), R213 (= R188), D248 (≠ V223), R271 (= R246)
Sites not aligning to the query:
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
36% identity, 83% coverage: 46:284/287 of query aligns to 72:309/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: L77 (= L51), A78 (= A52), A79 (≠ S53), I81 (≠ T55), V96 (≠ T70), T119 (≠ A94), Y146 (= Y121), K150 (= K125), P173 (≠ L148), A174 (≠ S149), N175 (= N150), V176 (≠ P151)
- binding uridine-5'-diphosphate-glucose: I81 (≠ T55), R84 (≠ A58), S121 (= S96), G123 (= G98), Y146 (= Y121), A174 (≠ S149), N175 (= N150), A187 (≠ Q162), G188 (= G163), V189 (= V164), F193 (= F168), R204 (≠ D179), V205 (= V180), F206 (≠ W181), R213 (= R188), D248 (≠ V223), R271 (= R246)
Sites not aligning to the query:
Q14376 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Homo sapiens (Human) (see 13 papers)
29% identity, 84% coverage: 48:287/287 of query aligns to 85:341/348 of Q14376
- F88 (≠ L51) binding
- G90 (≠ S53) to E: in GALAC3; 800-fold decrease in UDP-galactose epimerization activity; dbSNP:rs28940882
- K92 (≠ T55) binding
- V94 (≠ P57) to M: in GALAC3; generalized; 30-fold decrease in UDP-galactose epimerization activity; 2-fold decrease in affinity for UDP-galactose; 24% of normal activity with respect to UDP-N-acetylgalactosamine; dbSNP:rs121908047
- D103 (≠ Q66) to G: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs28940883
- S132 (= S96) mutation to A: Loss of activity.
- SA-T 132:134 (≠ SGGA 96:99) binding
- Y157 (= Y121) active site, Proton acceptor; mutation to F: Loss of activity.
- K161 (= K125) binding
- A180 (≠ S143) to V: in dbSNP:rs3204468
- L183 (= L146) to P: in GALAC3; peripheral; 3-fold decrease in UDP-galactose epimerization activity; dbSNP:rs121908045
- Y185 (≠ L148) binding
- YFN 185:187 (≠ LSN 148:150) binding
- NNL 206:208 (≠ GVI 163:165) binding
- NVF 224:226 (≠ DVW 179:181) binding
- R239 (= R188) binding
- K257 (vs. gap) to R: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; does not affect affinity for UDP-galactose; dbSNP:rs28940884
- REGD 300:303 (≠ RPFD 246:249) binding
- C307 (≠ N253) mutation to Y: No effect on activity towards UDP-galactose. Loss of activity towards UDP-N-acetylgalactosamine.
- L313 (≠ R259) to M: in GALAC3; 6-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs3180383
- G319 (≠ L265) to E: in GALAC3; nearly normal activity towards UDP-galactose; mild impairment under conditions of substrate limitation; dbSNP:rs28940885
- R335 (≠ Q281) to H: in GALAC3; 2-fold decrease in UDP-galactose epimerization activity; dbSNP:rs368637540
Sites not aligning to the query:
- 12:14 binding
- 33:37 binding
- 34 N → S: in GALAC3; peripheral; nearly normal activity towards UDP-galactose; dbSNP:rs121908046
- 66:67 binding
1ek6A Structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose (see paper)
29% identity, 84% coverage: 48:287/287 of query aligns to 85:341/346 of 1ek6A
- active site: S132 (= S96), A133 (≠ G97), T134 (≠ A99), Y157 (= Y121), K161 (= K125)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F88 (≠ L51), A89 (= A52), G90 (≠ S53), K92 (≠ T55), S130 (≠ A94), S131 (= S95), S132 (= S96), Y157 (= Y121), K161 (= K125), Y185 (≠ L148), P188 (= P151)
- binding uridine-5'-diphosphate-glucose: S132 (= S96), Y157 (= Y121), F186 (≠ S149), N187 (= N150), N207 (≠ V164), L208 (≠ I165), N224 (≠ D179), V225 (= V180), F226 (≠ W181), R239 (= R188), Y241 (≠ F190), V277 (= V223), R300 (= R246), D303 (= D249)
Sites not aligning to the query:
- binding 1,4-dihydronicotinamide adenine dinucleotide: 9, 12, 13, 14, 33, 34, 36, 37, 66, 67
1i3lA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
29% identity, 84% coverage: 48:287/287 of query aligns to 84:340/347 of 1i3lA
- active site: S131 (= S96), A132 (≠ G97), T133 (≠ A99), Y156 (= Y121), K160 (= K125)
- binding galactose-uridine-5'-diphosphate: N186 (= N150), N206 (≠ V164), L207 (≠ I165), N223 (≠ D179), V224 (= V180), F225 (≠ W181), R238 (= R188), Y240 (≠ F190), V276 (= V223), R299 (= R246), D302 (= D249)
- binding nicotinamide-adenine-dinucleotide: F87 (≠ L51), A88 (= A52), G89 (≠ S53), K91 (≠ T55), S129 (≠ A94), S130 (= S95), S131 (= S96), Y156 (= Y121), K160 (= K125), Y184 (≠ L148), P187 (= P151)
Sites not aligning to the query:
1i3kA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
29% identity, 84% coverage: 48:287/287 of query aligns to 84:340/347 of 1i3kA
- active site: S131 (= S96), A132 (≠ G97), T133 (≠ A99), Y156 (= Y121), K160 (= K125)
- binding nicotinamide-adenine-dinucleotide: F87 (≠ L51), A88 (= A52), G89 (≠ S53), K91 (≠ T55), S129 (≠ A94), S131 (= S96), Y156 (= Y121), K160 (= K125), Y184 (≠ L148), P187 (= P151)
- binding uridine-5'-diphosphate-glucose: F185 (≠ S149), N186 (= N150), N206 (≠ V164), L207 (≠ I165), N223 (≠ D179), V224 (= V180), F225 (≠ W181), R238 (= R188), Y240 (≠ F190), V276 (= V223), R299 (= R246), D302 (= D249)
Sites not aligning to the query:
1hzjA Human udp-galactose 4-epimerase: accommodation of udp-n- acetylglucosamine within the active site (see paper)
29% identity, 84% coverage: 48:287/287 of query aligns to 84:340/345 of 1hzjA
- active site: S131 (= S96), A132 (≠ G97), T133 (≠ A99), Y156 (= Y121), K160 (= K125)
- binding nicotinamide-adenine-dinucleotide: F87 (≠ L51), A88 (= A52), G89 (≠ S53), K91 (≠ T55), S129 (≠ A94), S131 (= S96), Y156 (= Y121), K160 (= K125), Y184 (≠ L148), P187 (= P151)
- binding uridine-diphosphate-n-acetylglucosamine: N186 (= N150), N206 (≠ V164), L207 (≠ I165), N223 (≠ D179), V224 (= V180), F225 (≠ W181), R238 (= R188), Y240 (≠ F190), V276 (= V223), R299 (= R246), D302 (= D249)
Sites not aligning to the query:
Q8NBZ7 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UGD; UXS-1; hUXS; hUXS1; EC 4.1.1.35 from Homo sapiens (Human) (see 4 papers)
30% identity, 83% coverage: 46:284/287 of query aligns to 154:392/420 of Q8NBZ7
- L159 (= L51) binding
- S161 (= S53) binding
- K177 (≠ Q69) binding
- T178 (= T70) binding
- N185 (≠ R77) binding
- G188 (≠ Q80) binding
- K191 (≠ R83) binding
- R192 (≠ Q84) binding
- A200 (= A94) binding
- E204 (≠ A99) mutation to A: Reduced UDP-glucuronic acid decarboxylase activity.
- Y231 (= Y121) active site, Proton acceptor; binding ; mutation to F: Abolished UDP-glucuronic acid decarboxylase activity.
- K235 (= K125) binding
- R236 (≠ L126) mutation to H: Strongly reduced UDP-glucuronic acid decarboxylase activity, caused by a local unfolding of the active site that allows for a rotation of the dimer interface, leading to the formation of a homohexamer.
- Y245 (≠ E135) binding
- Q248 (= Q138) binding
- E249 (≠ H139) binding
- T261 (≠ P151) binding
- H267 (= H159) binding
- R272 (vs. gap) binding
- R361 (≠ N253) mutation to Q: Strongly reduced UDP-glucuronic acid decarboxylase activity.
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
- 98 binding
- 99 binding
- 100 binding
- 119 binding
- 120 binding
- 122 binding
- 123 binding
- 124 binding
- 144 binding
- 145 binding
- 149 binding
- 150 binding
2b69A Crystal structure of human udp-glucoronic acid decarboxylase
30% identity, 83% coverage: 46:284/287 of query aligns to 67:305/312 of 2b69A
- active site: T115 (≠ S96), S116 (≠ G97), E117 (≠ A99), Y144 (= Y121), K148 (= K125), R185 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: L72 (= L51), A73 (= A52), S74 (= S53), A76 (≠ T55), T91 (= T70), T115 (≠ S96), Y144 (= Y121), K148 (= K125), I171 (≠ L148), N173 (= N150), R185 (vs. gap)
- binding uridine-5'-diphosphate: P78 (= P57), N98 (≠ R77), G101 (≠ Q80), L102 (≠ A81), K104 (≠ R83), R105 (≠ Q84), Y158 (≠ E135), N173 (= N150), R185 (vs. gap), V186 (= V164), N189 (≠ V167), T201 (≠ D179), Y203 (≠ W181), Q208 (≠ V186), R210 (= R188), I244 (≠ V223), D270 (= D249)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 8, 11, 12, 13, 32, 33, 36, 37, 57, 58
- binding uridine-5'-diphosphate: 61, 62, 63
6dntA Udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid (see paper)
27% identity, 89% coverage: 28:283/287 of query aligns to 54:306/310 of 6dntA
- active site: S120 (= S96), S121 (≠ G97), A122 (= A99), Y144 (= Y121), K148 (= K125), A187 (≠ G163)
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: A80 (≠ S54), S120 (= S96), S121 (≠ G97), Y144 (= Y121), F172 (≠ S149), N173 (= N150), A187 (≠ G163), V188 (= V164), K191 (≠ V167), V203 (≠ D179), I204 (≠ V180), Y205 (≠ W181), Q210 (≠ V186), R212 (= R188), I246 (≠ V223), R269 (= R246), D272 (= D249)
- binding nicotinamide-adenine-dinucleotide: D57 (= D31), L58 (≠ C32), L76 (= L51), A77 (= A52), A78 (≠ S53), A80 (≠ S54), S118 (≠ A94), S119 (= S95), Y144 (= Y121), K148 (= K125), Y171 (≠ L148), V174 (≠ P151)
- binding zinc ion: E209 (≠ S185), H275 (≠ V252)
Sites not aligning to the query:
Q6GMI9 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UXS-1; EC 4.1.1.35 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
30% identity, 83% coverage: 46:283/287 of query aligns to 152:389/418 of Q6GMI9
- R234 (≠ L126) mutation to H: In Man o' war (mow) mutant; characterized by severe craniofacial defects. Fishes show defective organization and morphogenesis of chondrocytes, perichondrium and bone.
P27830 dTDP-glucose 4,6-dehydratase 2; EC 4.2.1.46 from Escherichia coli (strain K12) (see 2 papers)
29% identity, 83% coverage: 46:282/287 of query aligns to 76:330/355 of P27830
- T100 (= T70) binding
- D135 (≠ G97) active site, Proton donor
- E136 (≠ A99) active site, Proton acceptor
- Y160 (= Y121) active site, Proton acceptor
- YSASK 160:164 (≠ YGATK 121:125) binding
- N190 (≠ P151) binding
Sites not aligning to the query:
- 12:13 binding
- 33:36 binding
- 59:60 binding
7kn1A Crystal structure of udp-glucose-4-epimerase (gale) from stenotrophomonas maltophila with bound NAD and formylated udp- arabinopyranose
30% identity, 96% coverage: 11:286/287 of query aligns to 43:333/336 of 7kn1A
- active site: S126 (≠ G97), Y150 (= Y121), K154 (= K125)
- binding nicotinamide-adenine-dinucleotide: D60 (= D31), I61 (≠ C32), F82 (≠ L51), A83 (= A52), A84 (≠ S53), K86 (≠ T55), S124 (= S95), S125 (= S96), S126 (≠ G97), Y150 (= Y121), K154 (= K125), Y178 (≠ L148), P181 (= P151)
- binding UDP-4-deoxy-4-formamido-beta-L-arabinopyranose: V88 (≠ P57), S126 (≠ G97), Y150 (= Y121), N180 (= N150), S199 (≠ G163), N200 (≠ V164), L201 (≠ I165), Q217 (≠ D179), V218 (= V180), F219 (≠ W181), R232 (= R188), Y234 (≠ F190), V270 (= V223), R293 (= R246), D296 (= D249)
Sites not aligning to the query:
7k3pA The structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni
30% identity, 78% coverage: 46:268/287 of query aligns to 74:310/329 of 7k3pA
Sites not aligning to the query:
1bxkB Dtdp-glucose 4,6-dehydratase from e. Coli
28% identity, 83% coverage: 46:282/287 of query aligns to 76:324/344 of 1bxkB
- active site: S125 (≠ A87), T134 (≠ S96), D135 (≠ G97), E136 (vs. gap), S158 (≠ G119), Y160 (= Y121), S161 (≠ G122), K164 (= K125)
- binding nicotinamide-adenine-dinucleotide: L81 (= L51), A83 (≠ S53), T100 (= T70), I132 (≠ A94), S133 (= S95), T134 (≠ S96), K164 (= K125), C187 (≠ L148)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 8, 11, 12, 13, 33, 34, 35, 36, 38, 39, 59, 60
Query Sequence
>Ac3H11_1900 FitnessBrowser__acidovorax_3H11:Ac3H11_1900
MAAEGMAVWSVDRMLPQPGSAPWLAGEVQADCFDLASWWDRVGGADVIVHLASSTVPATA
SEDPVQDAQTNLVGTLRLLQALRQKGARPRLLFASSGGAVYGRPQFVPLSETHPTMPMGA
YGATKLAIEHHLRIEEAQHGLPSRILRLSNPYGEWQQPHGVQGVIAVFAHRALHGHSVDV
WGDGSVVRDFVYAADVGRAFVSAARHEGPTRTFNVGGGTGHSVNDIIHTLERLLGKAVER
RVFPARPFDPPVNVLDIQRAQEELLWTPAMAFEEGVAMSVQWLRTVP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory