SitesBLAST
Comparing Ac3H11_191 FitnessBrowser__acidovorax_3H11:Ac3H11_191 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q5SKN9 Long-chain-fatty-acid--CoA ligase; Long-chain fatty acyl-CoA synthetase; LC-FACS; EC 6.2.1.3 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
37% identity, 94% coverage: 24:538/548 of query aligns to 23:532/541 of Q5SKN9
- T184 (= T193) binding
- G302 (= G308) binding
- Q322 (≠ H328) binding
- G323 (≠ V329) binding
- T327 (= T333) binding
- E328 (= E334) binding
- D418 (= D425) binding
- K435 (= K442) binding
- K439 (≠ I446) binding
P0DX84 3-methylmercaptopropionyl-CoA ligase; MMPA-CoA ligase; EC 6.2.1.44 from Ruegeria lacuscaerulensis (strain DSM 11314 / KCTC 2953 / ITI-1157) (Silicibacter lacuscaerulensis) (see paper)
33% identity, 90% coverage: 44:537/548 of query aligns to 39:530/539 of P0DX84
- H231 (= H237) mutation to A: Retains 74% of wild-type activity.
- W235 (= W241) mutation to A: Almost completely abolishes the activity.
- G302 (≠ A307) mutation to P: Almost completely abolishes the activity.
- G303 (= G308) mutation to P: Almost completely abolishes the activity.
- W326 (≠ Y330) mutation to A: Retains 7.7% of wild-type activity.
- P333 (vs. gap) mutation to A: Retains 69% of wild-type activity.
- R432 (= R440) mutation to A: Retains 4.3% of wild-type activity.
- K434 (= K442) mutation to A: Retains 36% of wild-type activity.
- D435 (= D443) mutation to A: Retains 76% of wild-type activity.
- K438 (≠ I446) mutation to A: Retains 5.6% of wild-type activity.
- G440 (= G448) mutation to P: Retains 3.6% of wild-type activity.
- G441 (= G449) mutation to P: Retains 2.7% of wild-type activity.
- E442 (= E450) mutation to A: Retains 27% of wild-type activity.
- W443 (≠ N451) mutation to A: Retains 60% of wild-type activity.
- E474 (= E482) mutation to A: Retains 33% of wild-type activity.
- K523 (= K530) Plays an important role in catalysis; mutation to A: Retains 1.6% of wild-type activity.; mutation to E: Retains 1.4% of wild-type activity.; mutation to R: Retains 57% of wild-type activity.
- K526 (= K533) mutation to A: Retains 48% of wild-type activity.
6ijbB Structure of 3-methylmercaptopropionate coa ligase mutant k523a in complex with amp and mmpa (see paper)
33% identity, 90% coverage: 44:537/548 of query aligns to 39:530/538 of 6ijbB
- active site: T185 (= T193), H205 (≠ N213), H231 (= H237), S329 (≠ T333), E330 (= E334), K438 (≠ I446), W443 (≠ N451), A523 (≠ K530)
- binding 3-(methylsulfanyl)propanoic acid: W235 (= W241), G303 (= G308), A325 (≠ V329), W326 (≠ Y330), G327 (= G331), M328 (≠ L332)
- binding adenosine monophosphate: G303 (= G308), A304 (= A309), A305 (= A310), H324 (= H328), W326 (≠ Y330), G327 (= G331), M328 (≠ L332), S329 (≠ T333), Q359 (= Q363), D417 (= D425)
1v26B Crystal structure of tt0168 from thermus thermophilus hb8 (see paper)
36% identity, 93% coverage: 24:532/548 of query aligns to 16:502/510 of 1v26B
- active site: T177 (= T193), H197 (vs. gap), H223 (= H237), T320 (= T333), E321 (= E334), K432 (≠ I446), W437 (≠ N451)
- binding adenosine monophosphate: G295 (= G308), S296 (≠ A309), A297 (= A310), G316 (≠ V329), Y317 (= Y330), G318 (= G331), L319 (= L332), T320 (= T333), D411 (= D425), K428 (= K442), K432 (≠ I446), W437 (≠ N451)
- binding magnesium ion: T177 (= T193), E321 (= E334)
6ihkB Structure of mmpa coa ligase in complex with adp (see paper)
32% identity, 90% coverage: 44:537/548 of query aligns to 39:527/533 of 6ihkB
- active site: T185 (= T193), H202 (≠ N213), H228 (= H237), S326 (≠ T333), E327 (= E334), K435 (≠ I446), W440 (≠ N451), K520 (= K530)
- binding adenosine-5'-diphosphate: H228 (= H237), G300 (= G308), A301 (= A309), A302 (= A310), H321 (= H328), A322 (≠ V329), W323 (≠ Y330), G324 (= G331), M325 (≠ L332), S326 (≠ T333), Q356 (= Q363), D414 (= D425), R429 (= R440), K520 (= K530)
1v25A Crystal structure of tt0168 from thermus thermophilus hb8 (see paper)
36% identity, 86% coverage: 19:488/548 of query aligns to 11:464/491 of 1v25A
- active site: T177 (= T193), H197 (vs. gap), H223 (= H237), T320 (= T333), E321 (= E334), K432 (≠ I446), W437 (≠ N451)
- binding phosphoaminophosphonic acid-adenylate ester: H223 (= H237), V224 (≠ C238), G295 (= G308), S296 (≠ A309), A297 (= A310), Y317 (= Y330), G318 (= G331), L319 (= L332), T320 (= T333), D411 (= D425), I423 (= I437), K432 (≠ I446), W437 (≠ N451)
- binding magnesium ion: T177 (= T193), E321 (= E334)
8i3iA Acyl-acp synthetase structure bound to amp-pnp
30% identity, 95% coverage: 19:539/548 of query aligns to 17:520/522 of 8i3iA
- binding phosphoaminophosphonic acid-adenylate ester: T172 (= T193), G174 (= G195), T175 (= T196), T176 (= T197), K180 (= K201), G293 (= G308), A294 (= A309), A295 (= A310), Y315 (= Y330), M317 (≠ L332), S318 (≠ T333), D408 (= D425), R423 (= R440)
8i8dA Acyl-acp synthetase structure bound to mc7-acp
30% identity, 95% coverage: 19:539/548 of query aligns to 17:528/529 of 8i8dA
- binding adenosine monophosphate: G292 (≠ A307), G293 (= G308), A295 (= A310), G314 (≠ V329), Y315 (= Y330), G316 (= G331), M317 (≠ L332), S318 (≠ T333), D408 (= D425), K429 (≠ I446)
- binding 7-methoxy-7-oxidanylidene-heptanoic acid: H223 (= H237), W227 (= W241), G292 (≠ A307), G316 (= G331), P322 (≠ G337)
- binding N~3~-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-N-(2-sulfanylethyl)-beta-alaninamide: R93 (= R102), P220 (= P234), H223 (= H237), I269 (≠ V283), G432 (= G449)
8i8eA Acyl-acp synthetase structure bound to c18:1-acp
30% identity, 95% coverage: 19:539/548 of query aligns to 17:528/530 of 8i8eA
- binding adenosine monophosphate: G292 (≠ A307), G293 (= G308), A294 (= A309), A295 (= A310), G314 (≠ V329), Y315 (= Y330), M317 (≠ L332), S318 (≠ T333), D408 (= D425), R423 (= R440)
- binding 4'-phosphopantetheine: R93 (= R102), P220 (= P234), H223 (= H237)
8i49A Acyl-acp synthetase structure bound to atp
30% identity, 95% coverage: 19:539/548 of query aligns to 17:528/530 of 8i49A
8i22A Acyl-acp synthetase structure bound to pimelic acid monoethyl ester
30% identity, 95% coverage: 19:539/548 of query aligns to 17:528/530 of 8i22A
8i6mA Acyl-acp synthetase structure bound to amp-c18:1
30% identity, 95% coverage: 19:539/548 of query aligns to 15:526/528 of 8i6mA
- binding adenosine monophosphate: G291 (= G308), A293 (= A310), G312 (≠ V329), Y313 (= Y330), G314 (= G331), M315 (≠ L332), S316 (≠ T333), D406 (= D425), R421 (= R440)
- binding magnesium ion: M315 (≠ L332), S316 (≠ T333), E317 (= E334)
8i51A Acyl-acp synthetase structure bound to amp-mc7
30% identity, 95% coverage: 19:539/548 of query aligns to 15:526/528 of 8i51A
- binding adenosine monophosphate: G291 (= G308), A293 (= A310), Y313 (= Y330), M315 (≠ L332), S316 (≠ T333), D406 (= D425), R421 (= R440)
- binding 7-methoxy-7-oxidanylidene-heptanoic acid: W225 (= W241), G290 (≠ A307), G312 (≠ V329), G314 (= G331), M315 (≠ L332), P320 (≠ G337), I321 (≠ P338)
P9WQ37 Long-chain-fatty-acid--CoA ligase FadD13; Fatty acyl-CoA ligase; FACL; FACL13; Fatty acyl-CoA synthetase; ACS; FACS; Very-long-chain fatty-acyl-CoA synthetase; ACSVL; EC 6.2.1.3 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 4 papers)
31% identity, 94% coverage: 24:538/548 of query aligns to 7:495/503 of P9WQ37
- R9 (≠ E26) mutation to A: Alteration of the strength of the membrane binding; when associated with A-9; A-195; A-197 and A-244.
- R17 (≠ D34) mutation to A: Alteration of the strength of the membrane binding; when associated with A-9; A-17; A-197 and A-244.
- K172 (= K201) mutation to A: Slight reduction of the fatty acyl-CoA ligase activity. Slight increase of susceptibility to proteolysis.
- R195 (≠ P224) mutation to A: Alteration of the strength of the membrane binding; when associated with A-9; A-17; A-197 and A-244.
- R197 (≠ H226) mutation to A: Alteration of the strength of the membrane binding; when associated with A-9; A-17; A-195 and A-244.
- V209 (≠ C238) mutation to D: Strong reduction of the fatty acyl-CoA ligase activity. No significant change in the total expression level, however the cytoplasmic expression is reduced. Slight increase of susceptibility to proteolysis.
- A211 (≠ G240) mutation to G: Slight increase of the fatty acyl-CoA ligase activity. Reduced rate of proteolytic degradation.
- T214 (≠ F243) mutation to W: Shows a marked decrease in the activity with lauric and palmitic acid (C12 and C16 fatty acid) with a simultaneous increase in the activity with caprylic acid (C8 fatty acid).
- R244 (≠ G273) mutation to A: Alteration of the strength of the membrane binding; when associated with A-17; A-195; A-195 and A-197.
- A302 (≠ G331) mutation to G: Slight increase of the fatty acyl-CoA ligase activity. Reduced rate of proteolytic degradation.; mutation to W: Does not show activity with small, medium or long acyl chains.
- W377 (= W420) mutation to A: Strong reduction of the fatty acyl-CoA ligase activity. Enhanced affinity towards palmitic acid binding. No significant change in the total expression level, however the cytoplasmic expression is low. Slight increase of susceptibility to proteolysis.
- D382 (= D425) mutation to A: Strong reduction of the fatty acyl-CoA ligase activity. No significant change in the total expression level, however the cytoplasmic expression is reduced.
- R397 (= R440) mutation to A: Reduction of binding affinity for fatty acids.
- S404 (= S447) mutation to A: Slight reduction of the fatty acyl-CoA ligase activity. Enhanced affinity towards palmitic acid binding.
- G406 (= G449) mutation to L: No effect on the formation of acyl-adenylate intermediate. However, it shows very poor catalytic efficiency to form acyl-CoA.
- K487 (= K530) mutation to A: Strong reduction of the fatty acyl-CoA ligase activity. Reduction of binding affinity for ATP.
3r44A Mycobacterium tuberculosis fatty acyl coa synthetase (see paper)
31% identity, 94% coverage: 24:538/548 of query aligns to 10:495/502 of 3r44A
Sites not aligning to the query:
5gtdA O-succinylbenzoate coa synthetase (mene) from bacillus subtilis in complex with the acyl-adenylate intermediate osb-amp (see paper)
27% identity, 94% coverage: 23:537/548 of query aligns to 6:477/484 of 5gtdA
- active site: T151 (= T193), S171 (≠ N213), H195 (= H237), T288 (= T333), E289 (= E334)
- binding adenosine-5'-monophosphate: G263 (≠ A309), G264 (≠ A310), Y285 (= Y330), G286 (= G331), M287 (≠ L332), T288 (= T333), D366 (= D425), V378 (≠ I437)
- binding magnesium ion: F314 (≠ L359), S315 (≠ N360)
- binding 2-succinylbenzoate: H195 (= H237), S197 (≠ N239), A237 (= A290), L260 (≠ V306), G262 (= G308), G263 (≠ A309), G286 (= G331), M287 (≠ L332), S292 (≠ G337), Q293 (≠ P338)
5x8fB Ternary complex structure of a double mutant i454ra456k of o- succinylbenzoate coa synthetase (mene) from bacillus subtilis bound with amp and its product analogue osb-ncoa at 1.76 angstrom (see paper)
27% identity, 94% coverage: 23:537/548 of query aligns to 6:477/485 of 5x8fB
- active site: T151 (= T193), S171 (≠ N213), H195 (= H237), T288 (= T333), E289 (= E334), I387 (= I446), N392 (= N451), K470 (= K530)
- binding magnesium ion: Y23 (≠ H40), E24 (≠ G41), H70 (≠ F87), N178 (≠ E220), L202 (≠ P244), L214 (≠ C256), T296 (≠ V341), L297 (≠ C342), S298 (≠ A343)
- binding o-succinylbenzoyl-N-coenzyme A: K85 (≠ R102), L191 (= L233), P192 (= P234), H195 (= H237), I196 (≠ C238), S197 (≠ N239), A237 (= A290), V238 (≠ P291), L260 (≠ V306), G262 (= G308), G286 (= G331), M287 (≠ L332), S292 (≠ G337), Q293 (≠ P338), S388 (= S447), G389 (= G448), G390 (= G449), E391 (= E450), K420 (= K479), W421 (= W480), K450 (≠ G511), Y451 (≠ F512)
5burA O-succinylbenzoate coenzyme a synthetase (mene) from bacillus subtilis, in complex with atp and magnesium ion (see paper)
27% identity, 94% coverage: 23:537/548 of query aligns to 5:474/475 of 5burA
- active site: T150 (= T193), S170 (≠ N213), H194 (= H237), T287 (= T333), E288 (= E334)
- binding adenosine-5'-triphosphate: T150 (= T193), S151 (= S194), T153 (= T196), T154 (= T197), K158 (= K201), G263 (≠ A310), S283 (≠ V329), T287 (= T333), D365 (= D425), V377 (≠ I437), R380 (= R440)
5busA O-succinylbenzoate coenzyme a synthetase (mene) from bacillus subtilis, in complex with amp (see paper)
27% identity, 94% coverage: 23:537/548 of query aligns to 5:474/481 of 5busA
- active site: T150 (= T193), S170 (≠ N213), H194 (= H237), T287 (= T333), E288 (= E334)
- binding adenosine monophosphate: H194 (= H237), G262 (≠ A309), G263 (≠ A310), S283 (≠ V329), M286 (≠ L332), T287 (= T333), D365 (= D425), V377 (≠ I437), R380 (= R440), K467 (= K530)
7tz4A Salicylate adenylate pchd from pseudomonas aeruginosa containing 4- cyanosalicyl-ams (see paper)
30% identity, 93% coverage: 28:538/548 of query aligns to 31:525/530 of 7tz4A
- binding 5'-O-[(4-cyano-2-hydroxybenzoyl)sulfamoyl]adenosine: H232 (= H237), N233 (≠ C238), F234 (≠ N239), C238 (≠ F243), G305 (= G308), S306 (≠ A309), R307 (≠ A310), V327 (= V329), L328 (≠ Y330), G329 (= G331), M330 (≠ L332), A331 (≠ T333), I335 (≠ V341), D411 (= D425), V423 (≠ I437), K517 (= K530)
Query Sequence
>Ac3H11_191 FitnessBrowser__acidovorax_3H11:Ac3H11_191
MTSIFDQHLPRTEANFAPLSPLSFIERTAEVYPDRLAIVHGTLRQTWAQTYARCRQLASA
LVQAGIGKNDTVAVMLPNTPPMVEAHFGVPMAGAVLNALNTRLDPEAIAFMLDHGEAKVV
LVDPEFTGTMAKALALRTGTTPIRVIEVQDALYGPAVQGLGGTDYDAFVASGDATFAWRL
PADEWDAIALNYTSGTTGNPKGVVYHHRGAASNAISNVLEWDMPKHAVYLWTLPMFHCNG
WCFPWTIAARAGVNVCLRRVDAQAIFDAIRTHGVTHYCGAPIVHGLLVNAPEAMKAGIPA
GVKAMVAGAAPPASMIEGMEKMGFDLTHVYGLTEVYGPATVCAKHEAWDQLDIGERARLN
ARQGVRYHLERDVRVLDPETMQPVPQDGETMGEIMFKGNIAMKGYLKNPKATEEAFAGGW
FHSGDLAVQYPDGYIKIKDRSKDIIISGGENISSIEVEDVLYRHPDVLAAAVVAKPDAKW
GETPCAFVELKAGAEATPEDIVAHCKKHLAGFKVPRAVVFGELPKTSTGKIQKFELRKLA
GSAAAIDV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory