Comparing Ac3H11_1914 FitnessBrowser__acidovorax_3H11:Ac3H11_1914 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00348 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; L-3-hydroxyacyl CoA dehydrogenase; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Sus scrofa (Pig) (see paper)
32% identity, 36% coverage: 6:295/800 of query aligns to 27:312/314 of P00348
4pzeA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa (see paper)
34% identity, 36% coverage: 5:294/800 of query aligns to 1:279/283 of 4pzeA
4pzdA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with NAD+ (see paper)
34% identity, 36% coverage: 5:294/800 of query aligns to 1:279/283 of 4pzdA
Q16836 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Homo sapiens (Human) (see 7 papers)
33% identity, 36% coverage: 6:295/800 of query aligns to 27:312/314 of Q16836
1f17A L-3-hydroxyacyl-coa dehydrogenase complexed with nadh (see paper)
32% identity, 36% coverage: 6:295/800 of query aligns to 4:289/293 of 1f17A
1f12A L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa (see paper)
32% identity, 36% coverage: 6:295/800 of query aligns to 4:289/293 of 1f12A
1f0yA L-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and NAD+ (see paper)
32% identity, 36% coverage: 6:295/800 of query aligns to 4:289/291 of 1f0yA
P9WNP7 3-hydroxybutyryl-CoA dehydrogenase; Beta-hydroxybutyryl-CoA dehydrogenase; BHBD; EC 1.1.1.157 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 36% coverage: 6:294/800 of query aligns to 5:284/286 of P9WNP7
4kugA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with NAD from clostridium butyricum
30% identity, 36% coverage: 6:294/800 of query aligns to 1:278/282 of 4kugA
4kuhA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
30% identity, 36% coverage: 6:294/800 of query aligns to 1:278/280 of 4kuhA
6aa8E Crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with NAD+ (see paper)
32% identity, 36% coverage: 7:294/800 of query aligns to 1:277/281 of 6aa8E
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
29% identity, 38% coverage: 6:308/800 of query aligns to 361:654/763 of P40939
Sites not aligning to the query:
4om8A Crystal structure of 5-formly-3-hydroxy-2-methylpyridine 4-carboxylic acid (fhmpc) 5-dehydrogenase, an NAD+ dependent dismutase. (see paper)
29% identity, 36% coverage: 6:294/800 of query aligns to 2:280/309 of 4om8A
Q988C8 5-formyl-3-hydroxy-2-methylpyridine 4-carboxylate 5-dehydrogenase; FHMPC dehydrogenase; EC 1.2.1.100 from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) (Mesorhizobium loti (strain MAFF 303099)) (see 2 papers)
29% identity, 36% coverage: 6:294/800 of query aligns to 2:280/309 of Q988C8
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
28% identity, 37% coverage: 1:295/800 of query aligns to 331:617/731 of 4b3iA
Sites not aligning to the query:
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
28% identity, 37% coverage: 1:295/800 of query aligns to 329:615/728 of 8oqrA
Sites not aligning to the query:
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
28% identity, 37% coverage: 1:295/800 of query aligns to 329:615/729 of 8pf8A
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
28% identity, 37% coverage: 1:295/800 of query aligns to 330:616/730 of 8oquA
Sites not aligning to the query:
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
28% identity, 37% coverage: 1:295/800 of query aligns to 329:615/729 of 8oqtA
Sites not aligning to the query:
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
28% identity, 37% coverage: 1:295/800 of query aligns to 328:614/727 of 8oqoA
Sites not aligning to the query:
>Ac3H11_1914 FitnessBrowser__acidovorax_3H11:Ac3H11_1914
MSRFQVKKVAVLGAGVMGAQIAAHLVNVKVPVVLFDLPAKEGPKNGIVTKAVEGLKKLKP
SPLGLADDAALIQQANYEEHMHLLKECDLVIEAIAERMDWKLDLYTKIAPHVAKHAILAS
NTSGLSITKLSEVLPESIKPRFCGIHFFNPPRYMTLVELINTPTTQPEVLDQLEAFVTSG
LGKGVVRAHDTPNFVANRVGIAGMLATMKEVENFGLTYDVVDDLTGKKLGRASSGTFRTA
DVVGLDTMAHVIKTLQDNLSIETDPFYESFGTPAVLKKLLELGNLGQKAKAGFFKKVGRD
VMRFELDSEEYVPAGQKADEVYSRMLKKPAAERLRLLRNAEGAPGQFLWAILRNSFHYAA
VHLGTIADNARDVDQAMRWGFGMKQGPFELWQEAGWLEVAKMIQEDIDAGKALCKAPLPE
WVFKGPVAEAAGVHTAQGSWSASQNKFVPRRQLPVYERQIFPEALLGETSLPDWRTAGTT
IAESKALRTWTLDGQVLIASIKNKMHAISPEVMEALMEALELAESEYQGMVIWSGDAPFS
VGADLEATMPAFMVGGADAVESIEQELQNLMMRIRYAQVPVVAAIHGMALGGGCELAVYS
AKRVAHMESYIGLVEVGVGLVPGAGGLTYIARRAAENMAASTSKDILPFLTEGFTAAAMA
KVGTSALESRKLGFLLDGDVIVPHKDELLFVAINEAKSMAASGWCAPHKRLFPVAGRSGL
ATIKAQLVNMRDGGFISAYDFKIGAMIAEVVCGGDVDAGSMVSEEYLLTLERKVFCHLIA
QPKTHERILGMLSTGKPVRN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory