Comparing Ac3H11_1916 FitnessBrowser__acidovorax_3H11:Ac3H11_1916 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q56WD9 3-ketoacyl-CoA thiolase 2, peroxisomal; Acetyl-CoA acyltransferase 2; Beta-ketothiolase 2; Peroxisomal 3-oxoacyl-CoA thiolase 2; Peroxisome defective protein 1; EC 2.3.1.16 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
45% identity, 98% coverage: 8:397/399 of query aligns to 51:437/462 of Q56WD9
P09110 3-ketoacyl-CoA thiolase, peroxisomal; Acetyl-CoA C-myristoyltransferase; Acetyl-CoA acyltransferase; Beta-ketothiolase; Peroxisomal 3-oxoacyl-CoA thiolase; EC 2.3.1.16; EC 2.3.1.155; EC 2.3.1.9 from Homo sapiens (Human) (see 3 papers)
45% identity, 99% coverage: 3:397/399 of query aligns to 32:420/424 of P09110
Sites not aligning to the query:
2d3tC Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form v (see paper)
43% identity, 98% coverage: 7:397/399 of query aligns to 5:388/390 of 2d3tC
8gqmA Crystal structure of thiolase complexed with acetyl coenzyme a
42% identity, 97% coverage: 11:399/399 of query aligns to 5:375/377 of 8gqmA
P45359 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; CaTHL; EC 2.3.1.9 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
42% identity, 98% coverage: 6:397/399 of query aligns to 1:390/392 of P45359
4c2jD Crystal structure of human mitochondrial 3-ketoacyl-coa thiolase in complex with coa (see paper)
41% identity, 97% coverage: 10:398/399 of query aligns to 11:394/395 of 4c2jD
P42765 3-ketoacyl-CoA thiolase, mitochondrial; Acetyl-CoA acetyltransferase; Acetyl-CoA acyltransferase; Acyl-CoA hydrolase, mitochondrial; Beta-ketothiolase; Mitochondrial 3-oxoacyl-CoA thiolase; T1; EC 2.3.1.16; EC 2.3.1.9; EC 3.1.2.-; EC 3.1.2.1; EC 3.1.2.2 from Homo sapiens (Human) (see paper)
41% identity, 97% coverage: 10:398/399 of query aligns to 8:395/397 of P42765
4xl4A Crystal structure of thiolase from clostridium acetobutylicum in complex with coa (see paper)
42% identity, 98% coverage: 6:397/399 of query aligns to 1:390/392 of 4xl4A
6pccA Crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex hexanoyl coenzyme a (see paper)
42% identity, 99% coverage: 3:397/399 of query aligns to 1:401/403 of 6pccA
6pcbA Crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex with coa (see paper)
42% identity, 99% coverage: 3:397/399 of query aligns to 1:401/403 of 6pcbA
P07097 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Shinella zoogloeoides (Crabtreella saccharophila) (see 2 papers)
41% identity, 98% coverage: 9:399/399 of query aligns to 5:392/392 of P07097
8opuC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
41% identity, 98% coverage: 7:397/399 of query aligns to 2:397/399 of 8opuC
1ou6A Biosynthetic thiolase from zoogloea ramigera in complex with acetyl-o- pantetheine-11-pivalate
41% identity, 97% coverage: 11:399/399 of query aligns to 7:392/392 of 1ou6A
2vu2A Biosynthetic thiolase from z. Ramigera. Complex with s-pantetheine-11- pivalate. (see paper)
41% identity, 97% coverage: 11:399/399 of query aligns to 4:389/389 of 2vu2A
1dm3A Acetylated biosynthetic thiolase from zoogloea ramigera in complex with acetyl-coa (see paper)
41% identity, 97% coverage: 11:399/399 of query aligns to 4:389/389 of 1dm3A
1dlvA Biosynthetic thiolase from zoogloea ramigera in complex with coa (see paper)
41% identity, 97% coverage: 11:399/399 of query aligns to 4:389/389 of 1dlvA
2vu1A Biosynthetic thiolase from z. Ramigera. Complex of with o-pantheteine- 11-pivalate. (see paper)
41% identity, 97% coverage: 11:399/399 of query aligns to 6:391/391 of 2vu1A
8oqmD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-10
41% identity, 98% coverage: 7:397/399 of query aligns to 3:397/399 of 8oqmD
Sites not aligning to the query:
5f38D X-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution (see paper)
42% identity, 98% coverage: 6:397/399 of query aligns to 3:393/394 of 5f38D
8opyD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-b-dnq
41% identity, 98% coverage: 7:397/399 of query aligns to 3:399/401 of 8opyD
>Ac3H11_1916 FitnessBrowser__acidovorax_3H11:Ac3H11_1916
MAQKQVQDAYIVAATRTPIGRSGRGYFKNTRPDDLLVAAIKSAMLQVPTLDPKAIEDAII
GCSFPEGEQGMNMARIAVGLAFNHPVGGVTVNRFCASGITALQMAADRIRVGEADVLIAG
GAESMSLVPMGGNKPSFNAEVFARDEDVGIAYGMGLTAEKVAQQWKISREAQDAFALESH
LRAIKAQKAGEFTDEITPFEVVERSPNLATGEVVEKRRTVSLDEGPRPDTSLEGLAKLKP
VFAARGSVTAGNSSQTSDGAGALIVASEKAVKQFGLTPLARFVSYAARGVPPEIMGIGPI
EAIPAALRYAGLKSDDIGWYELNEAFAAQSLAVINTLGLNPANVNPMGGAIALGHPLGAT
GAIRAATVVHALRRHKLKYGMVTMCVGTGQGAAGIIEAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory