SitesBLAST
Comparing Ac3H11_1931 FitnessBrowser__acidovorax_3H11:Ac3H11_1931 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
51% identity, 98% coverage: 2:710/727 of query aligns to 15:723/731 of 4b3iA
- active site: G79 (≠ A75), E100 (= E96), R104 (≠ K100), G127 (= G123), E130 (= E126), P151 (= P147), E152 (= E148), G160 (= G156), S452 (= S444), H473 (= H465), E485 (= E477), S523 (= S515)
- binding adenosine-5'-diphosphate: Q640 (≠ E633), P641 (≠ W634), P642 (≠ S635), L643 (≠ V636), Q644 (= Q637)
- binding coenzyme a: T38 (≠ V30), V40 (≠ T32), A77 (= A73), G79 (≠ A75), D80 (= D76), V81 (≠ L77), E152 (= E148), F315 (= F303), Q319 (≠ N307)
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
51% identity, 98% coverage: 2:710/727 of query aligns to 12:720/727 of 8oqoA
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
51% identity, 98% coverage: 2:710/727 of query aligns to 12:720/728 of 8oqlA
- binding Hexafluorophosphate anion: V37 (≠ T32), N39 (≠ C34), G75 (= G74), D77 (= D76), M81 (≠ T80), V92 (≠ A91), T95 (≠ E94), P148 (= P147), E149 (= E148), L152 (= L151), Q180 (≠ E178), Q260 (≠ T252), K362 (= K357), D363 (= D358), V364 (= V359), V430 (= V425), D476 (= D471), K477 (= K472), M478 (= M473), P479 (≠ K474), K506 (= K501)
- binding formamide: V78 (≠ L77), K79 (= K78)
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
51% identity, 98% coverage: 2:710/727 of query aligns to 13:721/729 of 8pf8A
- binding [2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boronic acid: G76 (= G74), F169 (≠ L167), N173 (≠ G171), S177 (≠ Y175), I193 (≠ L190), F313 (= F303)
- binding bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]-bis(oxidanyl)boranuide: M39 (= M33), N40 (≠ C34), E41 (≠ R35), T81 (≠ A79), D92 (≠ N90), V93 (≠ A91)
- binding [(2~{R})-2,3-bis(oxidanyl)propoxy]-[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]borinic acid: M39 (= M33), G77 (≠ A75), D78 (= D76), M82 (≠ T80), V93 (≠ A91)
- binding (2~{R})-3-bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boranyloxypropane-1,2-diol: T152 (= T150), R184 (≠ L181), A311 (≠ T301), F312 (= F302), I673 (= I668)
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
51% identity, 98% coverage: 2:710/727 of query aligns to 14:722/730 of 8oquA
- binding 4-chloranylbenzenesulfonic acid: M40 (= M33), N41 (≠ C34), E42 (≠ R35), G77 (= G74), G78 (≠ A75), D79 (= D76), V80 (≠ L77), D90 (= D87), V94 (≠ A91), L124 (= L121), G125 (= G122), P150 (= P147), E151 (= E148)
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
51% identity, 98% coverage: 2:710/727 of query aligns to 13:721/729 of 8oqtA
- binding 4-bromanylbenzenesulfonic acid: E41 (≠ R35), G76 (= G74), G77 (≠ A75), D78 (= D76), V79 (≠ L77), M82 (≠ T80), D89 (= D87), V93 (≠ A91), T96 (≠ E94), T96 (≠ E94), P149 (= P147), E150 (= E148)
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
51% identity, 98% coverage: 2:710/727 of query aligns to 13:721/729 of 8oqnA
- binding 1-benzyl-1H-pyrazole-4-carboxylic acid: M39 (= M33), M82 (≠ T80), E150 (= E148), Q172 (≠ M170), F175 (≠ Q173), V176 (≠ P174), Q181 (≠ E178), T241 (= T232), F254 (≠ A245), N257 (≠ M248), Q261 (≠ T252), L262 (≠ T253), P266 (vs. gap), P268 (= P258), Q282 (≠ M272), V283 (= V273), G302 (= G292), Q303 (≠ P293), V304 (= V294), S521 (= S515), G525 (= G519)
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
51% identity, 98% coverage: 2:710/727 of query aligns to 13:721/729 of 8opvA
- binding resveratrol: M39 (= M33), A75 (= A73), G76 (= G74), M82 (≠ T80), E128 (= E126), P149 (= P147), E150 (= E148), T152 (= T150), L153 (= L151), R184 (≠ L181), F296 (≠ L286)
8opuA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
51% identity, 98% coverage: 2:710/727 of query aligns to 13:721/729 of 8opuA
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
51% identity, 98% coverage: 2:710/727 of query aligns to 13:721/728 of 8oqrA
- binding 4-cyanobenzenesulfonic acid: G76 (= G74), G77 (≠ A75), T81 (≠ A79), M82 (≠ T80), M82 (≠ T80), A85 (≠ L83), D89 (= D87), T96 (≠ E94), L123 (= L121), G124 (= G122), P149 (= P147), E150 (= E148), S366 (= S360), L367 (≠ A361), E368 (= E362), A420 (= A414), V421 (= V415), F422 (= F416)
8oqsB Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
51% identity, 98% coverage: 2:710/727 of query aligns to 19:727/735 of 8oqsB
- binding 4-phenylbenzenesulfonic acid: M45 (= M33), I50 (≠ Q38), G82 (= G74), G83 (≠ A75), D84 (= D76), T87 (≠ A79), T87 (≠ A79), M88 (≠ T80), M88 (≠ T80), A91 (≠ L83), D95 (= D87), D98 (≠ N90), V99 (≠ A91), T102 (≠ E94), T102 (≠ E94), E134 (= E126), E156 (= E148), L159 (= L151), F302 (≠ L286), F302 (≠ L286), F319 (= F303), S456 (= S444), T457 (= T445), M485 (= M473), P486 (≠ K474), G523 (= G511), S527 (= S515), N535 (≠ M523), P560 (= P548), M575 (≠ S563), I578 (≠ V566), I578 (≠ V566), I682 (= I671), M683 (≠ F672), G686 (= G675)
Sites not aligning to the query:
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
51% identity, 98% coverage: 2:710/727 of query aligns to 7:715/723 of 8oqqA
8oqpA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
51% identity, 98% coverage: 2:710/727 of query aligns to 7:715/723 of 8oqpA
- binding 2-azanyl-5-sulfo-benzoic acid: G28 (≠ S28), S29 (≠ P29), A63 (= A67), K64 (= K68), K64 (= K68), K65 (≠ T69), P143 (= P147), E144 (= E148), L147 (= L151), F307 (= F303), M473 (= M473), P548 (= P548), S599 (≠ P600), L602 (≠ A603), K603 (≠ G604), S661 (= S662), T662 (≠ V663), G674 (= G675), A698 (≠ E693), R705 (≠ D700)
8oqvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-109
51% identity, 98% coverage: 2:710/727 of query aligns to 11:719/726 of 8oqvA
- binding 4-nitrobenzenesulfonic acid: E39 (≠ R35), G74 (= G74), M80 (≠ T80), V91 (≠ A91), T94 (≠ E94), T94 (≠ E94), E148 (= E148), L151 (= L151), R182 (≠ L181), S448 (= S444), S519 (= S515), R520 (= R516), L562 (≠ T558), L566 (= L562), I570 (≠ V566)
Sites not aligning to the query:
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
51% identity, 98% coverage: 2:710/727 of query aligns to 2:703/711 of 7o4uA
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
34% identity, 97% coverage: 21:727/727 of query aligns to 20:706/707 of 1wdmA
- active site: A69 (= A75), N89 (≠ E94), N93 (≠ K99), G117 (= G123), E120 (= E126), P139 (= P147), E140 (= E148), P147 (= P155), G148 (= G156), S430 (= S444), H451 (= H465), E463 (= E477), N501 (≠ S515)
- binding acetyl coenzyme *a: K142 (≠ T150), D297 (= D305), M459 (= M473), N501 (≠ S515), P534 (= P548), Y652 (≠ F672), L658 (≠ A678)
- binding nicotinamide-adenine-dinucleotide: G321 (= G335), A322 (= A336), I324 (≠ M338), M325 (= M339), D344 (= D358), V401 (= V415), E403 (= E417), N428 (= N442), S430 (= S444), N454 (≠ S468)
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
34% identity, 97% coverage: 21:727/727 of query aligns to 20:714/715 of 1wdlA
- active site: A69 (= A75), N89 (≠ E94), N93 (≠ K99), G117 (= G123), E120 (= E126), P139 (= P147), E140 (= E148), P147 (= P155), G148 (= G156), S430 (= S444), H451 (= H465), E463 (= E477), N501 (≠ S515)
- binding nicotinamide-adenine-dinucleotide: A322 (= A336), I324 (≠ M338), M325 (= M339), D344 (= D358), I345 (≠ V359), A400 (= A414), V401 (= V415), E403 (= E417), N428 (= N442), T429 (= T443), S430 (= S444)
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
34% identity, 97% coverage: 21:727/727 of query aligns to 20:714/715 of P28793
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
31% identity, 96% coverage: 13:710/727 of query aligns to 44:744/763 of P40939
- V282 (≠ L242) to D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- I305 (≠ L264) to N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- L342 (≠ T301) to P: in LCHAD deficiency; dbSNP:rs137852772
- E510 (= E477) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
33% identity, 96% coverage: 17:715/727 of query aligns to 12:691/707 of 6yswA
- active site: A66 (= A75), I71 (≠ T80), A84 (≠ G93), Q88 (≠ K99), G112 (= G123), E115 (= E126), P136 (= P147), E137 (= E148), G145 (= G156), D264 (≠ R280), S422 (= S444), H443 (= H465), E455 (= E477), N493 (≠ S515)
- binding coenzyme a: E23 (≠ S28), M25 (≠ V30), A66 (= A75), D67 (= D76), I68 (≠ L77), P136 (= P147), E137 (= E148), L140 (= L151), T290 (≠ M306), K293 (≠ I309)
Query Sequence
>Ac3H11_1931 FitnessBrowser__acidovorax_3H11:Ac3H11_1931
MQTIRYELIPAQGTDGEVAVITFDETNSPVNTMCRQWQQELGEVTARVAADRERLGAALK
GIVLASAKTSFFAGADLKATMRLTPADAPNAFGEIERMKKHFRTLETLGIPVVACLNGAA
LGGGWEVALVAHYRIAVADPKIQFGLPEVTLGLMPGATGVTKMTRLLGLMGAQPYILEGK
LFNPAEALELQLVHELVATREQLLPAALAHISTHPHAVQPWDDKNYKMPGGTPANPKIAG
ALTVAPAMLKKTTRGRYPAPEAALAAMVEGAMVDYDTALRIESRYLARLMTGPVARNMIN
TFFFDMNAIKSGKSRPAVNGAVAPRYKPQKVGILGAGMMGAGIAWAQASRGIATVLKDVS
AEKAEAGKAYSAKLTQARVDKGRMTAEAQQALLSRITPTASAADLAGCDLIIEAVFESRD
LKAKVTQEAEPQLAPGGFFASNTSTLPISGLATASSRPEKFVGIHFFSPVDKMKLVEIIR
GNQTDDETVARAFDYVQALGKVPIVVNDSRGFYTSRTFGTFVMEGAAMLGEGIPAAAIEN
AAMQAGLPVGPLAVMDETALTLSVHVLDQTRADYATEGKTYTATPGELLVERMVKELKRP
GRAGGGGFYDYPAGAKKHLWPELKPLFEKPGVEWSVQEIQDRLLYRQAIETARCLAEGVL
TSVHDANIGSIFGIGFPAWTGGAMQFIYGTGVEAFLKRADELAAKYGTGFALTARARATV
ANFQPVY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory