Comparing Ac3H11_1949 FitnessBrowser__acidovorax_3H11:Ac3H11_1949 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
77% identity, 91% coverage: 30:343/345 of query aligns to 1:314/314 of 4p8bA
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
36% identity, 81% coverage: 51:329/345 of query aligns to 21:290/301 of 4pdhA
Sites not aligning to the query:
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
34% identity, 88% coverage: 26:329/345 of query aligns to 3:293/304 of 4pakA
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
34% identity, 88% coverage: 26:329/345 of query aligns to 2:292/303 of 4p9kA
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
31% identity, 89% coverage: 27:334/345 of query aligns to 1:294/301 of 4nq8B
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
27% identity, 83% coverage: 46:333/345 of query aligns to 16:294/303 of 4pddA
Sites not aligning to the query:
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
29% identity, 87% coverage: 35:333/345 of query aligns to 9:300/310 of 7bbrA
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
29% identity, 87% coverage: 35:333/345 of query aligns to 8:299/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
29% identity, 87% coverage: 35:333/345 of query aligns to 8:299/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
29% identity, 87% coverage: 35:333/345 of query aligns to 8:299/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
29% identity, 87% coverage: 35:333/345 of query aligns to 8:299/310 of 7bcnA
4p3lA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound glucuronate, spg p6122 (see paper)
28% identity, 82% coverage: 43:324/345 of query aligns to 12:284/303 of 4p3lA
Sites not aligning to the query:
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
29% identity, 84% coverage: 35:324/345 of query aligns to 7:287/304 of 4x8rA
A3QCW5 C4-dicarboxylate-binding periplasmic protein DctP from Shewanella loihica (strain ATCC BAA-1088 / PV-4) (see paper)
32% identity, 88% coverage: 32:336/345 of query aligns to 34:331/336 of A3QCW5
4pf8A Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. Nas-14.1 (target efi-510299) with bound beta-d- galacturonate (see paper)
32% identity, 86% coverage: 44:339/345 of query aligns to 12:300/300 of 4pf8A
Sites not aligning to the query:
4mnpA Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. Nucleatum atcc 25586 (see paper)
31% identity, 90% coverage: 31:342/345 of query aligns to 1:302/305 of 4mnpA
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
30% identity, 85% coverage: 33:326/345 of query aligns to 2:286/300 of 4n8yA
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
29% identity, 92% coverage: 14:329/345 of query aligns to 10:314/329 of P44542
4oanA Crystal structure of a trap periplasmic solute binding protein from rhodopseudomonas palustris haa2 (rpb_2686), target efi-510221, with density modeled as (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2- acetolactate) (see paper)
32% identity, 83% coverage: 57:341/345 of query aligns to 32:309/312 of 4oanA
Sites not aligning to the query:
4xeqB Crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid
34% identity, 64% coverage: 51:272/345 of query aligns to 21:238/304 of 4xeqB
Sites not aligning to the query:
>Ac3H11_1949 FitnessBrowser__acidovorax_3H11:Ac3H11_1949
MKLRTFLTSAVAAAAALAFTAPAAIAQTTYKSEYRMSLVLGTAFPWGKGGELWANKVRER
TQGRINIKLYPGVSLIQGDQTREFSALRQGVIDMAVGSTINWSPQVKQLNLFSLPFLFPD
YAAVDAVTQGDVGKSIFATLDKAGVVPLAWGENGYREISNSKKAIKTPEDLKGLKIRVVG
SPLFLDTFTALGANPTQMSWADAQPAFASGAVDGQENPLSIFTAAKLHSVAQKNITLWGY
VNDPLIFVVNKEIWNSWTPADREIVKQAAIDAGKEEIAIARKGVVEADKPLLKDISALGV
TVTQLSPAERAAFVKVTRPVYDKWKGQIGADLVNMAEKAIAARKQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory