Comparing Ac3H11_195 FitnessBrowser__acidovorax_3H11:Ac3H11_195 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
28% identity, 62% coverage: 90:325/379 of query aligns to 5:241/302 of 8hkbA
7ndrD Crystal structure of tphc in an open conformation (see paper)
28% identity, 57% coverage: 90:306/379 of query aligns to 5:221/293 of 7ndrD
7ndsA Crystal structure of tphc in a closed conformation (see paper)
28% identity, 57% coverage: 90:306/379 of query aligns to 5:221/294 of 7ndsA
Sites not aligning to the query:
6hkeB Matc (rpa3494) from rhodopseudomonas palustris with bound malate (see paper)
27% identity, 62% coverage: 99:332/379 of query aligns to 15:250/296 of 6hkeB
Sites not aligning to the query:
>Ac3H11_195 FitnessBrowser__acidovorax_3H11:Ac3H11_195
MVTIATRLKETAMQLGNLLSQCAQADPTICTSPFFAKDRMTTSFNRRQILARATATGAIG
ALGAPFATSAWAQAAARSAPPKAPKLAGTLRIVIPANPGGGWDQTGRALGAALVGAGAAD
QVEYENIGGKGGTIGLAKYAEKYGNDANTLFMGGMVMVGAVALQKPAVDMGQIQPLARLT
SDYLVAAVAAKSPIKNTKDLADALRADLRGMPVAGGSAGGVDHMFAGVLARAAKAKPEEL
VYKPFPGGADVVEALVSGNAAVGLSGYSEFSDAIAAGKLRALGVSSRRSAFGLPAFREQG
LDAVMANWRGVFTGKGVAPARTAEMLAAVEAATHHESWTRTLKQNRWEPSWLTGKDLAEF
MELDLTTARVMVYLLKLKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory