Comparing Ac3H11_1954 FitnessBrowser__acidovorax_3H11:Ac3H11_1954 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vhaA Debp (see paper)
41% identity, 91% coverage: 25:296/299 of query aligns to 4:274/276 of 2vhaA
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
41% identity, 92% coverage: 21:296/299 of query aligns to 1:275/278 of 2ia4B
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
41% identity, 83% coverage: 25:271/299 of query aligns to 2:247/503 of 8ovoA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
30% identity, 83% coverage: 28:276/299 of query aligns to 5:238/243 of 5eyfB
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
27% identity, 86% coverage: 19:274/299 of query aligns to 34:282/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
27% identity, 86% coverage: 19:274/299 of query aligns to 34:282/287 of 6h1uA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
27% identity, 86% coverage: 19:274/299 of query aligns to 35:283/288 of 6h2tA
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
28% identity, 78% coverage: 36:269/299 of query aligns to 4:225/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
28% identity, 78% coverage: 36:268/299 of query aligns to 4:226/226 of 4zv1A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
31% identity, 81% coverage: 27:267/299 of query aligns to 1:228/229 of 5t0wA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
30% identity, 78% coverage: 37:269/299 of query aligns to 2:222/231 of 2q2cA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
30% identity, 78% coverage: 37:269/299 of query aligns to 12:232/241 of 2q2aA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
30% identity, 78% coverage: 37:269/299 of query aligns to 6:226/235 of 2pvuA
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
27% identity, 79% coverage: 29:265/299 of query aligns to 7:232/251 of 1xt8B
2pyyB Crystal structure of the glur0 ligand-binding core from nostoc punctiforme in complex with (l)-glutamate (see paper)
27% identity, 70% coverage: 61:268/299 of query aligns to 19:211/217 of 2pyyB
Sites not aligning to the query:
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
26% identity, 81% coverage: 29:269/299 of query aligns to 3:229/229 of 6svfA
4zefA Crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis
30% identity, 60% coverage: 37:214/299 of query aligns to 17:186/239 of 4zefA
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
22% identity, 81% coverage: 29:271/299 of query aligns to 1:235/237 of 4i62A
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
22% identity, 80% coverage: 29:266/299 of query aligns to 3:229/231 of 2v25A
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
25% identity, 76% coverage: 27:253/299 of query aligns to 2:221/240 of 4h5fA
>Ac3H11_1954 FitnessBrowser__acidovorax_3H11:Ac3H11_1954
MKVQHWRFAKGLVALGCLLAASVQAATVLERVSAGGKLVIAHRESSVPFSYVDSQSGKPV
GYAVDLCLRMAEVVRKKTGKKDMEVEFVAVTPANRITMIEEGKADMECGSTTNNAERRQK
VAFTIPHFITGARLLVKSASPIDKVEDLNGKKLVSTKGTTPLKAADQANRERLMGITIME
APDHAKAVEMVEKGEADAFVMDDVLLYGLAAGRPDPKALKVVGRFMTTEPLAIMLPKNDP
EFKKLVDEEMRRLITSRDIYPIYDKWFNKPIPPNNTVLNLPVSYLLRDFWKYPTDQVPF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory