Comparing Ac3H11_1955 FitnessBrowser__acidovorax_3H11:Ac3H11_1955 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vhaA Debp (see paper)
43% identity, 94% coverage: 12:293/299 of query aligns to 1:276/276 of 2vhaA
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
43% identity, 94% coverage: 12:293/299 of query aligns to 2:277/278 of 2ia4B
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
43% identity, 82% coverage: 22:266/299 of query aligns to 2:247/503 of 8ovoA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
30% identity, 71% coverage: 51:262/299 of query aligns to 23:225/226 of 4zv1A
Sites not aligning to the query:
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
31% identity, 71% coverage: 51:262/299 of query aligns to 23:223/225 of 4zv2A
Sites not aligning to the query:
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
31% identity, 61% coverage: 81:262/299 of query aligns to 59:234/243 of 5eyfB
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
30% identity, 80% coverage: 25:262/299 of query aligns to 2:228/229 of 5t0wA
4gvoA Putative l-cystine abc transporter from listeria monocytogenes
29% identity, 71% coverage: 51:262/299 of query aligns to 21:227/236 of 4gvoA
Sites not aligning to the query:
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
29% identity, 70% coverage: 54:262/299 of query aligns to 24:221/226 of 8eyzA
Sites not aligning to the query:
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
31% identity, 72% coverage: 50:264/299 of query aligns to 22:224/224 of 4ymxA
Sites not aligning to the query:
5l9oB Crystal structure of agrobacterium tumefaciens c58 strain pbp soca in complex with glucopine (see paper)
27% identity, 75% coverage: 46:269/299 of query aligns to 25:238/243 of 5l9oB
5lomB Crystal structure of the pbp soca from agrobacterium tumefaciens c58 in complex with dfg at 1.5 a resolution (see paper)
27% identity, 75% coverage: 46:269/299 of query aligns to 26:239/250 of 5lomB
5l9oA Crystal structure of agrobacterium tumefaciens c58 strain pbp soca in complex with glucopine (see paper)
27% identity, 75% coverage: 46:269/299 of query aligns to 24:237/241 of 5l9oA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
25% identity, 83% coverage: 20:268/299 of query aligns to 38:281/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
25% identity, 83% coverage: 20:268/299 of query aligns to 38:281/287 of 6h1uA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
25% identity, 83% coverage: 20:268/299 of query aligns to 39:282/288 of 6h2tA
4ohnA Crystal structure of an abc uptake transporter substrate binding protein from streptococcus pneumoniae with bound histidine
22% identity, 81% coverage: 24:266/299 of query aligns to 4:243/246 of 4ohnA
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
26% identity, 79% coverage: 26:261/299 of query aligns to 3:229/231 of 2v25A
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
27% identity, 79% coverage: 28:264/299 of query aligns to 5:229/229 of 6svfA
2pyyB Crystal structure of the glur0 ligand-binding core from nostoc punctiforme in complex with (l)-glutamate (see paper)
30% identity, 65% coverage: 69:262/299 of query aligns to 28:210/217 of 2pyyB
Sites not aligning to the query:
>Ac3H11_1955 FitnessBrowser__acidovorax_3H11:Ac3H11_1955
MKKHLLAIAVTALAAGSAFAQATDTLAKIKASGSVTLGVRESSGLSYTLGNGKYVGFHTE
MGEIVLADVQKQLGLPKLDIKYQPVTSQNRIPLVTNGTVDLECGSTTNNAARLKDVSFAV
TTYVEEVRMVVKANSGITSIKDLNGKTVATTTGTTSVQTLRKHERAGGIDFKEVMGKDHA
DSFLMLETGRAEAFVMDGSILAANISKSKSPADYKIVGEVLNVEPIACMLRKDDPAFKKA
VDDSIKRQIKDGSLAKLYDKWFMQPVPPANVKIGLPMSDATKEAWANPNDKPMEDYAKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory