Comparing Ac3H11_1956 FitnessBrowser__acidovorax_3H11:Ac3H11_1956 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
4ymtC Crystal structure of an amino acid abc transporter complex with arginines (see paper)
29% identity, 84% coverage: 28:238/252 of query aligns to 9:215/215 of 4ymtC
4ymwC Crystal structure of an amino acid abc transporter with histidines (see paper)
29% identity, 83% coverage: 28:237/252 of query aligns to 9:214/214 of 4ymwC
>Ac3H11_1956 FitnessBrowser__acidovorax_3H11:Ac3H11_1956
MSWDWQVFCQDTMDREVVQSCFGKGGDITYLDWMLSAWGWTVSVSLLALVLALVLGSLIG
TLRTLQDRPMIVRLGNAWVELFRNIPLLVQIFLWYHVIPSLFPVMKGVPGFALVVLALGF
FTSARIAEQVRSGIQALPRGQRYAGMAVGFTTFQTYRYVLLPMAFRIIIPPLTSETMNIF
KNSSVAFAVSVAELTMFAMQAQEETSRGIEVYLAVTSLYIISAFAINRIMAFIEKRVRIP
GMVVAGAAGGGH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory