Comparing Ac3H11_2048 FitnessBrowser__acidovorax_3H11:Ac3H11_2048 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 93% coverage: 19:395/405 of query aligns to 44:418/440 of O04373
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
36% identity, 93% coverage: 19:395/405 of query aligns to 6:371/380 of P54955
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 93% coverage: 18:395/405 of query aligns to 47:422/442 of P54968
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
34% identity, 84% coverage: 22:363/405 of query aligns to 15:350/389 of 4ewtA
Sites not aligning to the query:
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
36% identity, 81% coverage: 22:351/405 of query aligns to 18:344/398 of 6slfA
Sites not aligning to the query:
>Ac3H11_2048 FitnessBrowser__acidovorax_3H11:Ac3H11_2048
MQSLKYKAGGRAFSHIAQFHPELTALRRDLHAHPELGFEEVYTSKRVKEALTLCGVDEIH
DGIGRTGVVGVIRGRSTSSGSMVGLRADMDALPLAEHNDFSWKSCKPGLMHGCGHDGHTA
MLVGAARYLAETRNFDGTAVLVFQPGEEGFAGARVMMEDGLFDRFPVQSIYAMHNWPAMK
PGTVGINAGPMMAAADRFTIEITGRGGHGAHAYQTVDVLVVAAHIITAAQSIVSRNVRPI
ESAVVSICAAQAGDLGAFSVLPGSATLVGTVRTFDPVVQEMVEKRLKELCNAIALGFGAT
ATVHYERIYPATINSESEAIFAGDVAESLLGADHVVRDLEPSMGAEDFAFMLQTRPGAYL
RLGQGTGASGSALHNSRYDFNDDILPLGAALHASLIEQSMPLAMP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory