Comparing Ac3H11_2051 FitnessBrowser__acidovorax_3H11:Ac3H11_2051 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
36% identity, 90% coverage: 12:325/348 of query aligns to 1:321/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
37% identity, 91% coverage: 14:328/348 of query aligns to 4:319/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
37% identity, 91% coverage: 14:328/348 of query aligns to 3:308/310 of 4fwiB
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
37% identity, 73% coverage: 14:268/348 of query aligns to 3:247/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
37% identity, 73% coverage: 14:268/348 of query aligns to 3:247/253 of 7z15I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
37% identity, 73% coverage: 14:268/348 of query aligns to 3:247/250 of 7z16I
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 79% coverage: 14:288/348 of query aligns to 1:269/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
35% identity, 79% coverage: 14:288/348 of query aligns to 2:270/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
35% identity, 79% coverage: 14:288/348 of query aligns to 2:270/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
35% identity, 79% coverage: 14:288/348 of query aligns to 2:270/344 of 6cvlD
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
34% identity, 66% coverage: 14:243/348 of query aligns to 1:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
34% identity, 66% coverage: 14:243/348 of query aligns to 1:223/230 of 1l2tA
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
36% identity, 71% coverage: 13:259/348 of query aligns to 3:229/650 of 5ws4A
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 73% coverage: 14:268/348 of query aligns to 2:239/241 of 4u00A
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
34% identity, 66% coverage: 14:243/348 of query aligns to 5:223/233 of P75957
7mdyC Lolcde nucleotide-bound
34% identity, 66% coverage: 14:243/348 of query aligns to 2:220/226 of 7mdyC
7arlD Lolcde in complex with lipoprotein and adp (see paper)
34% identity, 66% coverage: 14:243/348 of query aligns to 2:220/222 of 7arlD
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
33% identity, 66% coverage: 14:243/348 of query aligns to 4:222/229 of 7v8iD
3c4jA Abc protein artp in complex with atp-gamma-s
32% identity, 74% coverage: 12:268/348 of query aligns to 1:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
32% identity, 74% coverage: 12:268/348 of query aligns to 1:241/242 of 3c41J
>Ac3H11_2051 FitnessBrowser__acidovorax_3H11:Ac3H11_2051
LNKNNKKSDIPMSLLEVKNLVVEFPGRRGTLRALDDISFSIAPGEILGVVGESGAGKSLT
GAAIIGLLEPPGRVASGQILLEGQRIDNLSNEEMRHIRGRRIGAIFQDPLTSLNPLYTVG
RQLTETILAHLPVTPAEARQRAIALLKDTGIPAAEERIDHYPHQFSGGMRQRVVIALALA
AEPKLIVADEPTTALDVSIQAQIITLLKNICKSRGAAVMLITHDMGVIAETCDRVAVLYA
GRVAEIGPVHDVINKPSHPYTSGLMASIPDMTMDRERLNQIDGAMPRLNAIPKGCAYNPR
CPQTFDRCMTERPDLMPAGSTRAACWLHAGASTTAPTATAATKAGVTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory