Comparing Ac3H11_2078 FitnessBrowser__acidovorax_3H11:Ac3H11_2078 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
7ag4D Crystal structure of active site mutant of sq isomerase (yihs-h248a) from salmonella enterica in complex with sulfofructose (sf) (see paper)
29% identity, 89% coverage: 38:413/424 of query aligns to 45:412/425 of 7ag4D
2zblA Functional annotation of salmonella enterica yihs-encoded protein (see paper)
29% identity, 89% coverage: 38:413/424 of query aligns to 33:400/416 of 2zblA
P32140 Sulfoquinovose isomerase; SQ isomerase; Sulfoquinovose-sulfofructose isomerase; SQ-SF isomerase; EC 5.3.1.31 from Escherichia coli (strain K12) (see paper)
29% identity, 89% coverage: 38:413/424 of query aligns to 33:400/413 of P32140
8h1lB Crystal structure of glucose-2-epimerase in complex with d-glucitol from runella slithyformis runsl_4512 (see paper)
24% identity, 91% coverage: 10:396/424 of query aligns to 4:406/423 of 8h1lB
3wkhA Crystal structure of cellobiose 2-epimerase in complex with epilactose (see paper)
24% identity, 89% coverage: 26:403/424 of query aligns to 34:397/410 of 3wkhA
3wkgA Crystal structure of cellobiose 2-epimerase in complex with glucosylmannose (see paper)
24% identity, 89% coverage: 26:403/424 of query aligns to 34:397/410 of 3wkgA
3wkiA Crystal structure of cellobiose 2-epimerase in complex with cellobiitol (see paper)
24% identity, 89% coverage: 26:403/424 of query aligns to 34:397/407 of 3wkiA
P0DKY4 Cellobiose 2-epimerase; CE; EC 5.1.3.11 from Ruminococcus albus (see paper)
22% identity, 93% coverage: 15:408/424 of query aligns to 6:388/389 of P0DKY4
P17560 N-acylglucosamine 2-epimerase; AGE; GlcNAc 2-epimerase; N-acetyl-D-glucosamine 2-epimerase; Renin-binding protein; RnBP; EC 5.1.3.8 from Sus scrofa (Pig) (see paper)
29% identity, 25% coverage: 300:403/424 of query aligns to 284:394/402 of P17560
Sites not aligning to the query:
P51606 N-acylglucosamine 2-epimerase; AGE; GlcNAc 2-epimerase; N-acetyl-D-glucosamine 2-epimerase; Renin-binding protein; RnBP; EC 5.1.3.8 from Homo sapiens (Human) (see paper)
28% identity, 25% coverage: 300:403/424 of query aligns to 294:404/427 of P51606
Sites not aligning to the query:
>Ac3H11_2078 FitnessBrowser__acidovorax_3H11:Ac3H11_2078
MAIPPYPDFRSAAFLRQHLRATMAFYDPVATDASGGQFHFFLDDGTVYNTHTRHLVSATR
FVVTHAMLYRTTGEARYQVGMRHALEFLRTAFLDPATGGYAWLIDWQDGRATVQDTTRHC
YGMAFVMLAYARAYEAGVPEARVWLAEAFDTAEQHFWQPAAGLYADEASPDWQLTSYRGQ
NANMHACEAMISAFRATGERRYIERAEQLAQGICQRQAALSDRTHAPAAEGWVWEHFHAD
WSVDWDYNRHDRSNIFRPWGYQVGHQTEWAKLLLQLDALLPADWHLPCAQRLFDTAVERG
WDAEHGGLYYGMAPDGSICDDGKYHWVQAESMAAAAVLAVRTGDARYWQWYDRIWAYCWA
HFVDHEHGAWFRILHRDNRNTTREKSNAGKVDYHNMGACYDVLLWALDAPGFSKESRSAA
LGRP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory